summaryrefslogtreecommitdiff
diff options
context:
space:
mode:
authorChristian Grothoff <christian@grothoff.org>2020-04-20 20:25:32 +0200
committerChristian Grothoff <christian@grothoff.org>2020-04-20 20:25:32 +0200
commit871e6bd1e1a03069772e3df6b7e5d316dae76596 (patch)
tree1629290301194c6f578ed7671f7cee68e3496bb5
parentab752e95910fe5a077be9e4807b2d8536ce3fc70 (diff)
downloadexchange-871e6bd1e1a03069772e3df6b7e5d316dae76596.tar.gz
exchange-871e6bd1e1a03069772e3df6b7e5d316dae76596.tar.bz2
exchange-871e6bd1e1a03069772e3df6b7e5d316dae76596.zip
remove old logo
-rw-r--r--doc/logos/ai/logotalerv2.ai3474
-rw-r--r--doc/logos/eps/icon_taler.epsbin242881387 -> 0 bytes
-rw-r--r--doc/logos/fonts/OldNewspaperTypes.ttfbin85804 -> 0 bytes
-rw-r--r--doc/logos/fonts/perpetue/Perpetua.ttfbin60216 -> 0 bytes
-rw-r--r--doc/logos/fonts/perpetue/Perpetua_Bold.ttfbin58512 -> 0 bytes
-rw-r--r--doc/logos/fonts/perpetue/Perpetua_Bold_Italic.ttfbin75620 -> 0 bytes
-rw-r--r--doc/logos/fonts/perpetue/Perpetua_Italic.ttfbin76080 -> 0 bytes
-rw-r--r--doc/logos/ico/favicon1616.icobin1150 -> 0 bytes
-rw-r--r--doc/logos/ico/favicon4848.icobin15086 -> 0 bytes
-rw-r--r--doc/logos/png/icon_taler.pngbin1835737 -> 0 bytes
-rw-r--r--doc/logos/png/logo_taler.pngbin377176 -> 0 bytes
11 files changed, 0 insertions, 3474 deletions
diff --git a/doc/logos/ai/logotalerv2.ai b/doc/logos/ai/logotalerv2.ai
deleted file mode 100644
index d474079d..00000000
--- a/doc/logos/ai/logotalerv2.ai
+++ /dev/null
@@ -1,3474 +0,0 @@
-%PDF-1.5 %
-1 0 obj <</Metadata 2 0 R/OCProperties<</D<</ON[5 0 R 248 0 R 489 0 R 730 0 R]/Order 731 0 R/RBGroups[]>>/OCGs[5 0 R 248 0 R 489 0 R 730 0 R]>>/Pages 3 0 R/Type/Catalog>> endobj 2 0 obj <</Length 50398/Subtype/XML/Type/Metadata>>stream
-<?xpacket begin="" id="W5M0MpCehiHzreSzNTczkc9d"?>
-<x:xmpmeta xmlns:x="adobe:ns:meta/" x:xmptk="Adobe XMP Core 5.3-c011 66.145661, 2012/02/06-14:56:27 ">
- <rdf:RDF xmlns:rdf="http://www.w3.org/1999/02/22-rdf-syntax-ns#">
- <rdf:Description rdf:about=""
- xmlns:dc="http://purl.org/dc/elements/1.1/">
- <dc:format>application/pdf</dc:format>
- <dc:title>
- <rdf:Alt>
- <rdf:li xml:lang="x-default">logotalerv2</rdf:li>
- </rdf:Alt>
- </dc:title>
- </rdf:Description>
- <rdf:Description rdf:about=""
- xmlns:xmp="http://ns.adobe.com/xap/1.0/"
- xmlns:xmpGImg="http://ns.adobe.com/xap/1.0/g/img/">
- <xmp:CreatorTool>Adobe Illustrator CS6 (Macintosh)</xmp:CreatorTool>
- <xmp:CreateDate>2014-09-16T12:36:31+02:00</xmp:CreateDate>
- <xmp:ModifyDate>2014-09-18T11:52:58+02:00</xmp:ModifyDate>
- <xmp:MetadataDate>2014-09-18T11:52:58+02:00</xmp:MetadataDate>
- <xmp:Thumbnails>
- <rdf:Alt>
- <rdf:li rdf:parseType="Resource">
- <xmpGImg:width>256</xmpGImg:width>
- <xmpGImg:height>192</xmpGImg:height>
- <xmpGImg:format>JPEG</xmpGImg:format>
- <xmpGImg:image>/9j/4AAQSkZJRgABAgEASABIAAD/7QAsUGhvdG9zaG9wIDMuMAA4QklNA+0AAAAAABAASAAAAAEA&#xA;AQBIAAAAAQAB/+4ADkFkb2JlAGTAAAAAAf/bAIQABgQEBAUEBgUFBgkGBQYJCwgGBggLDAoKCwoK&#xA;DBAMDAwMDAwQDA4PEA8ODBMTFBQTExwbGxscHx8fHx8fHx8fHwEHBwcNDA0YEBAYGhURFRofHx8f&#xA;Hx8fHx8fHx8fHx8fHx8fHx8fHx8fHx8fHx8fHx8fHx8fHx8fHx8fHx8fHx8f/8AAEQgAwAEAAwER&#xA;AAIRAQMRAf/EAaIAAAAHAQEBAQEAAAAAAAAAAAQFAwIGAQAHCAkKCwEAAgIDAQEBAQEAAAAAAAAA&#xA;AQACAwQFBgcICQoLEAACAQMDAgQCBgcDBAIGAnMBAgMRBAAFIRIxQVEGE2EicYEUMpGhBxWxQiPB&#xA;UtHhMxZi8CRygvElQzRTkqKyY3PCNUQnk6OzNhdUZHTD0uIIJoMJChgZhJRFRqS0VtNVKBry4/PE&#xA;1OT0ZXWFlaW1xdXl9WZ2hpamtsbW5vY3R1dnd4eXp7fH1+f3OEhYaHiImKi4yNjo+Ck5SVlpeYmZ&#xA;qbnJ2en5KjpKWmp6ipqqusra6voRAAICAQIDBQUEBQYECAMDbQEAAhEDBCESMUEFURNhIgZxgZEy&#xA;obHwFMHR4SNCFVJicvEzJDRDghaSUyWiY7LCB3PSNeJEgxdUkwgJChgZJjZFGidkdFU38qOzwygp&#xA;0+PzhJSktMTU5PRldYWVpbXF1eX1RlZmdoaWprbG1ub2R1dnd4eXp7fH1+f3OEhYaHiImKi4yNjo&#xA;+DlJWWl5iZmpucnZ6fkqOkpaanqKmqq6ytrq+v/aAAwDAQACEQMRAD8A9U4q7FXYq7FXYq7FXYq7&#xA;FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7F&#xA;XYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYqkHn&#xA;Lz35W8naZ+kdfvktYmqIIftTTMP2Yox8THffsO5AxV4lqP55fmf5v5jyLpUWi6QWMUer6gY2kZqh&#xA;fh9T9yp5OoYBX41BJAxViV/5Y826oyt5w87zrLKob6pPctDGrcI2YKJGSIhGnUHgvVZBtxrgVJrn&#xA;yn5NW48x2ei3VvNBc2trHpV5qFeSTGaJ7hlkeNaHgsg5UGx232CrI28syWOl2d95U8z3OixW0U1x&#xA;eXsdxcMsscdsvFOCSUaQTW8hZBGPhkBPZcKo22/Pf81vImox6Z5yt7fW4CCSwaNLkKkjRN+9gqnJ&#xA;WQ1WROXiRir3TyD+ank7zxal9Gu6XkahrjTpwI7mP5pU8l/ylJGKsuxV2KuxV2KuxV2KuxV2KuxV&#xA;2KuxV2KuxV2KuxV2KuxV2KuxV2KuxV2KuxV2KsG/Nb80tO8iaRGwj+va9fkxaRpaVLSyHbmwX4vT&#xA;UkVpuTsPZV4GnlTUNVv280/mTPLqGrXgKWNjs9vzV2UWy/Vnd+akf3SJxUtVyxDpir1Hy9+WWp30&#xA;cE2pXcuk2jxktp9okdvM3xzKpd46rCXhmpJHDRflsALVnej+QfJukqPqOk2yuNzO6CWUnxMj8nr9&#xA;OBKerFEiBFRVQbBQABiqUar5L8p6sjJqGk2txyFC5iUP9DqA4+g4q8y8/wD/ADj/ABan6l/ot3LN&#xA;d8afVL2QyVVRskczfEPYPX5jDavnnUNH8w+Vdb+s2rT6Zq1hJUMKxyxN/Qg/Ij2xQ+nPyQ/O2Dzr&#xA;anSNY4W/ma1QFwKKlyg29WMdiP21+kbdCr1rFXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FUv1zzDoWg&#xA;2Rvda1CDTrUbercyLGCfBeR+I+w3xV5Tr3/OVX5c2EjRaZDe6y42EsEQhh2/ypyj/cmKsXk/5zCI&#xA;ciLygzJ2ZtQCn7hbN+vFUXp//OX2ku6/pPyzc20f7TW1zHcEfIOlvX78VeieVPz2/LLzLIlva6st&#xA;leyEBbO/H1ZyT0Cs37pifBXJxVn4IIqOmKuxV2KuxVB6zq9ho2k3mrahJ6VlYwvcXEngkaljQdzt&#xA;sO5xV8iwebtY8yeYtS82eYtHt7zTdYSQaUblDJ9UW0bjAsRhKXCJzkEbvGU5SGvKoIwK96/LnyC9&#xA;rOfNGuxV128QejAzNILSGlFjDPVjIV/vHO5NfE1BKUg/5yM8t2d1odnrJjv7q/tri2t4LW0SeWP0&#xA;DcpLdMyQq1CYUarNtQUG+IV2p3+teTvyj05vKz3c11LJDbQSSQPdyxIUdhyQglalAnJkNK0pWmKq&#xA;HmHzHrHmLyL5R1WeyuYdRGs2T3KRwTKyD05BI7KAWSOp/b26VxVX/MLV/wAx7Tzl5XOjTXcOhNDE&#xA;0v1eD14pbgzFbiO7+AqqegV4s0qcdyvJgFxVOTq3nqf8z/qkd3c2/l+Kzs5fqz2iC1mnlE4uFS5a&#xA;HmxSkLfDLsdqeCqZfmb+W9l5v0kvGqxa5bIfqdz0D9zDJ4q3Y/snfxBVfId4mr+Wddi1KyL2Wpaf&#xA;PUA/C0csbUZHHzBVh9GFD7S/LTzzaedfKdprUAEcrjhdQVqY5V2dT9PT2wqyrFXYq7FXYq7FXYq7&#xA;FXYq7FXYq7FXin5w/wDORVj5Xnm0Dywseo+YEql1cNVre0b+U0/vJR/KDRe+9VxV87vZ+cfO2r/X&#xA;tWubjU76c0V5KudzXjGg+FV8FUAe2BXp/lr/AJxs1y5jSW+WOzQ0NJ2q9P8AUQNT6aY2rMoP+ca9&#xA;LVBz1MBu4W3qPvMgxtUJqf8AzjTCyH6nfQyt2EsbRfipkxtXmPm/8kNf0ZWkltWWEdJk+OL/AIJa&#xA;0+mmKrPIv5vefPy8uI7OZm1PQVID6bcsTwUf8s8hqYj7br7d8VfV/knzz5d856KmraHcerCTxnha&#xA;izQyUqY5UqeLD7j1BIwqn+KuxV5D/wA5Da2fqWg+U4b02V3r94GSQQrcKfqjI0aSozIoR53jqzVF&#xA;AdiK4qlfljyvb3HnOy0WNIRp+jKdTvzayh4Jpmcrb0jiWKCMScfW4JGo6dTVmBV6j5xn1C38pa1P&#xA;pt3Dp+oRWNw9pf3JVYLeVYmKTSlw6hI2+JiykUG4wJfJDfmr+eXJkk/MLRpFBoSs+lUPyrBhQqR/&#xA;mr+cITg/n3S+P8q3Ojgfcbc4qxq5/wCcg/zohuJ7eLzOJIonaPnHa6e6MVNCVZYOLLtsw6jGlT2y&#xA;/OT83b60SVfPNjGDQqlzJpULU7Vje2qp9q40q9/zW/O4kFPP+j1HQtPpJp/yQxV7Z+QPmf8AMbWL&#xA;W4bzXqVtrMTuz2moWrQMhjACFAbdY0PF1bt9OApYt/zkh5PitdYt9bt0CwauhjuaDYXMIFG8P3kf&#xA;/EScIQlP/OLfmyXTfNN75amaltqA9eFSdhLH8LU/1gR92FX1ZirsVdirsVdirsVdirsVdirsVeKf&#xA;85FfnDN5XsF8saBP6fmHUY+VxcofitLZqiqntLJSi9wPi68Tirwz8svy01LzRqaRxoSCec0z14ot&#xA;d3c/51wK+tPKPkbQfK9msNhCGueNJrxwPUc96fyr/kjAlkOKuxV2KrXjSRGSRQ6MKMrCoIPYg4q8&#xA;j/M/8mLDULSbUNFgCyqC01ko2I7mL3/yfu8MNq8D8seZvMH5Z+bI9VsKyWzER31kxIjuIa7o3+UO&#xA;qN2PtUFQ+0vLvmDS/MOh2Wt6XL61hfRiWB+hodirDsysCrDsRhVMcVfOH51W0uqfnbo6TQxT6ZYW&#xA;AhZJ51hj+sSpcTDkxDsmwQ1VSRSo3xVn/wCTmnRxL5hvPTWKZtQ+pFEkkmASyhSJR6kxMjUNd23y&#xA;JS9BvLO1vbSezu4UuLS5jaG4t5VDxyRyAq6OrAhlZTQg4q82uf8AnHL8rJ53l/REMfMk8I4o1UV7&#xA;ABaAY2qn/wBC2flZ/wBWuP8A4CP/AJpxtXyZ5g8tW9p5m8w2donG1s9UvraBadI4bmSNRt4Bckh7&#xA;f+Rn5KeQ/Mnke01LVbFJrqRFLuVQmpHuDgJS9E/6Fs/Kz/q1x/8AAR/804LVlPk78t/LXlEt+hoj&#xA;CjKV9IEBACeRooAA3xVJPz809Lr8tr2cir6fNb3Mfz9UQsf+AmbEK+YfId6+mfmdo1yhp/pQU08H&#xA;BX+OSQ+60bkgbxFcVbxV2KuxV2KuxV2KuxV2KoHXdZstE0W+1i+bhaafBJcznvxiUsQK9zSgHjir&#xA;4WW61Xzt5yu9YvgZLzUrgysgq3EMaRxL34otFX2GBX2T5A8n2vlfy/BZIi/W5AHvZR1aSn2a+C9B&#xA;9/fAljmqf85E/k7pWqXmlX+vmK/0+eS1u4RZ3z8JoXMci8kgZTRlIqCRjSqSf85J/ku/2Nfkb5af&#xA;qJ/7F8aVbL/zkv8AkpC3GXzC8bHcB7DUVNPpt8aVdH/zkn+TEq84tekkUdWXT9RI+8W+NKtb/nJb&#xA;8lU+15gdfnYaiP8AsXxpU88mfnF+XHnTVZdK8s6v9fv4YGupYfq11DSFHSNm5TxRr9qRRStd8Vea&#xA;/n5+XsCE6vaRhYLsn1VA2Saldv8AW6/fhCEu/wCcVvOk1pq2oeSL2T9zOGvNMVj9mWPaeNf9dKPT&#xA;/JPjhV9L4q+WP+ciPNHmLQPzHnstMuWs49RtrO8e4iLLKREJYAlQ3EpUE/ZrXvir1H/nHy5a58j3&#xA;E8knq3EmoTvO9KEu6RuTtQb8siUvTcVdirsVfIFzoBvNb8z3AWtdc1YVp4X0wySHs3/ONIp+W9kP&#xA;BV/VkSl6zirsVYH+eU0cX5W64XNOa26KPFmuYgMQr5M0NTJ570lV3P1qI0Hsa4UPvS3/ALiP/VH6&#xA;sKqmKuxV2KuxV2KuxV2KuxV4/wD85Ta5Jp/5YGxiYq+sXsFo9OvppyuG3+cIB+eKvK/+cb/Lkd95&#xA;nhuZUqlmrXRB8Uoqfc7A4Cr6rwJeJ+YPy0/Me817Uruz8q/lvcWtxdTy29xqFhdPeSRvIzI9y6xl&#xA;WmZTWQjq1cVQI/K381R08o/lcP8At3Xn/VPFXhf54+WvMemedbSy1zT9B026OmxTpbeWYZbezKNP&#xA;Mgd0lCsZiUIY/wAoXwwhDLvyK8l+edY8q38+iaJ5N1O0g1GSBp/M1rcXF4riCFzHG0SsohpIGA/m&#xA;LHviVein8rPzUPXyh+Vp/wC3def9U8CWcflb5J17QrrULvzBoPlLS7uRI4rG48rWklvI0ZLNOlw8&#xA;qKxUssZUL4GvbFWT+dtJTVfK2o2rLyb0mli8ecY5inzpTFXyFpF+3ln80NE1VTwS3voTMen7p39O&#xA;YfTG7DCh9xYVfNX/ADl55fdLry95jjUmMiXT7l+wIPqwj6f3n3Yqjv8AnGDzJGy6hokjgNMi3Vup&#xA;/mj+CQD3IKn6MBV79gS7FXYq+bNI1Cyhl80RSgeodd1ihPvfTZJDO/8AnGw1/Lm0I6UXIlL1jFXY&#xA;q8k/P/UUurfQvKUcnGXVLsXN2RU+naWwPN3ChiFDMGrQ/ZOxxCvKtHn0rzd+dOnNokFv+jrMoxub&#xA;aORPUbioPISpEwChOKjj798kh9cgUAHhirsVdirsVdirsVdirsVdir54/wCcwZWGl+V4duD3Ny58&#xA;aokYH/EzgVd/zi/Egj1CTbkIIwPGhap/ViVe+YEuxV2Kvl3/AJyP003v5s2wArw0K0/G8vP6YQhn&#xA;n/OLVsbbybr8J2467L+NjZnAUvZsVdirTqrqVbdWBBHscVfDP5jLw1Esp4sCSCNiCMKH3hhViP5r&#xA;eSo/OXkbUtFoPrTJ61g5/ZuIvij37An4T7E4q+O/InmTU/KvmaGfi0N9p85WWB6qQyEpJE/hUVU4&#xA;Ffa/lzzBp3mDRrbVtPfnb3C1p+0jD7SNToynY4EplirsVfFesa41r5l80wBqcdb1Xb53spySHvX/&#xA;ADjQa/lrZHxRf1ZEpetYqhdT1Ow0vT7jUdQmW3srVGlnmfYKqip/sHfFXzZf+bbrULrXPzIvY2ij&#xA;9P6tolsJza3cVpG4XnCxVl+PmVdlaodiFr9lihkv/OM3lK9kN95t1RSbu9laQOVCVZ6liFUBQKno&#xA;NsKvoHFXYq7FXYq7FXYq7FXYq7FXhv8Azlvpkk/kbS9RQEix1FVlA6BJ4nXkf9mqj6cVY3/zjBqs&#xA;a6jcWTGhnt24DxaNgaf8DywFX0bgS7FXYq8L/MzTEv8A84nRv2fL9kRX/mMvcIQyb8h7VbXTfNMC&#xA;9E11x/3LrLAUvTsVdiqF1W8Wy0y7u2NBbwvJX/VUnFXxVrlodc856dpMY5NfXcNsAP8Ai6VU7fPC&#xA;h90YVdir5s/5yN/J6dbp/Ovl6DkW31e1jG5Kj+/UeNPtAfPFWB/lT+beo+Vb4UJuLCagu7Jmor9g&#xA;6nfi48foOBX1V5V85+XvNFkLrSLpZSADNbNRZoiezx1qPn0PY4Ep5ir89vPmoGHz95ujrSmtal+N&#xA;3JkkPq7/AJxl/wDJZ2H/ABjT9WRKXo3mLzPoPlywN9rN4lpBuEDGryN/JHGKu7eyjFXhfm384dSu&#xA;9WjvdS0s23lGGUxR2zshuw6ShTePEGYMEZeHFkKbleXMgg0hiei2Oqfmhr1tpljYwWXlzTJBxaKN&#xA;k9VY5JPTkb1GdwAszcU5bVpvQYVfV+haLZaLpcGn2aBIYVoABSp7nFUfirsVdirsVdirsVdirsVd&#xA;irGfzL8qDzZ5F1nQQB693bk2hbYC4iIkhJPYeoi19sVfIH5VeZ7ny55ntpnVkltpaSxNs23wSIQe&#xA;hpUYFfa1nd295aQ3ds4kt50WSJx0KsKg4Eq2KuxV8+/nDqx0783uYbiX0CyH3Xl7hCGW/wDOPV39&#xA;b0PzNcVrz119/lp9kMBS9VxV2KvOvzq81Q6V5cOno4Fze7uK7iJTX/hmFPvxCvGP+cevLcvmT80G&#xA;1yWMvp+go1wzn7JnkBjgX5/akH+rkkPrXFXYqtkjSRGjkUMjCjKdwQcVfO/5tf8AOOHrzz655RKw&#xA;zNWSfTqURm7lOI+EnFXhyal5k8samEu0uNPv7dvgkBaKRSO6OtPwOBXo+hf85IedLKNY5riDUEUB&#xA;R9ci+IAf5cRiJPu1caViXmz8mb/Wdb1rVLTUTNquqSpqcVosMaQ89Rmjkki5md3AiF4vxOi1ofnh&#xA;VnXkC9/MLy75cPlpNWsNHktrVp7doYxeXEsUUpheXYzIIlEcjM6qSApNOmClSjVLzQtN1S6vNdvp&#xA;vMfmO2aezkiuf38sV1G7xBPq0p+xGQsgZiY2WqcQ1DhVNdI8n+evzNv63iPpPlzkGS1ZnkJVT8Hq&#xA;ysAZWChV7A8QTVt8VfRXk7yZo/lbTFstPjANB6ktAGYgUqaYqn+KuxV2KuxV2KuxV2KuxV2KuxV2&#xA;KvlP/nI/8tJ/L3mI+ddJiP6J1SUHUFQbQXjdXP8Akzdf9aviMVZH+Rv5uWsdtHoerS8bZm/0adjt&#xA;E7dVb/IY717H57AhXv4IIqNwehwJbxV8o/8AOT9+bT82LMg056Fa/heXeEIehf8AOJ9wbjyLrkx/&#xA;a12b8LK0GApe2YqlPmXzLpnl7TXvr5wAKiKIH4pG/lX+J7Yq+S/zB836x5u8w/VrVWur++lWGC2i&#xA;BJJY8UjQYUPp/wDKP8vYPIvk630tuL6lOfrOqzruGuHABVT/ACxgBF+Ve5wqzTFXYq7FXYqx/wAy&#xA;+Q/K/mOFo9Vskm5dX6HFXlet/wDOKnla4dn027ltSTUJ1A/HFUJcfkF56L1j81XI+wDIrBHPpMjR&#xA;lnWjMUMScSTtQYquh/5xnvb2NINb8w3d3bJIZVt5JHdA7dWVGYqCfGmKs58rfkX5H0BklW3NzOm/&#xA;OQ7V8aDFXoMMEMEaxwoEjUUVRsAMVX4q7FXYq7FXYq7FXYq7FXYq7FXYq7FUNqmmafqunXGnajAl&#xA;zY3cbRXEEgqrowoQcVfJH5ofkt5i/L+9k1jRBLqHlgkt6yjlLagn7FwB+yO0nTxoeoVOPy3/AD9v&#xA;9Lhjsb7/AEuyWgWKRqOg/wCK3329jt8saV7lon5peS9WjUx362srdYrn93T/AGZ+D/hsFJfL/wDz&#xA;l5qVtJ+Z+mTW0yTRHRIB6kbB1qLu62qtcIQ9G/5xI8w6NYflnqz6hfQ2zNrc7BJHVWK/VLUVC/aP&#xA;TsMSlnPmr89PLumxOmlj63OAaTSVSIe9DR2/DBSvA/MfnjzT531tLKwWbUdRum9OCGIV28FUbKo6&#xA;k9B1OFD3j8lfyPg8nKNc1wrd+aJ0K7UeK0VuqxHvIw2d/oG1SxV63irsVdirsVUJr2CGT025s9Ax&#xA;WOOSQgEkAngrUrQ4qs/Sdt/JP/0jz/8ANGKu/Sdt/JP/ANI8/wDzRirv0nbfyT/9I8//ADRirv0n&#xA;bfyT/wDSPP8A80Yq79J238k//SPP/wA0Yq79J238k/8A0jz/APNGKuXUrUsqkSpyIUF4ZUWrGgHJ&#xA;lA3OKorFXYq7FXYq7FXYq7FXYq7FXYq7FXYq0yqylWAKkUIO4IOKvJPPX/ONXknzDLJe6QzeXtSc&#xA;lma2UPbOx7tbkqF/55svyOKvJtU/5x8/ODRXY6b9X1i3WpRradY34jxSf0t/ZScVSZ/Kf5z2zenJ&#xA;5b1Bm8Y4mkHh9pOQxVEWv5c/nfqhCxaDcQq1KtcPFbgA+Pquh/DArMPLv/OLPmS/kWbzbrUdrAd2&#xA;tbGs0pHgZHCxofkr4Ve5+TPy88o+TbM22g2CW7uAJ7pv3lxLT/fkrfERXfiPhHYYqyPFXYqw/wA2&#xA;+b/N2nawmmeWvKx8xOlsLu9kN9FYrEru6RIvqo/N3MT+A264qi/IXnzS/OOlTXVrDNY31jO9nqul&#xA;XahLm0uY/tRyKPvVhsR71AVZLiqFj/46tx/xgg/4nLiqKxVak0Lu6I6s8dBIoIJUncVHbFWoZ4J0&#xA;LwSLKgZ4yyMGAeNijrUd1dSpHYimKvKfLsn5uyfm9rUd9c6HHp0dlpb3sMUd7K4s2nvzAsBaSNRO&#xA;SriV2Xj9khdiMVes4q87/wCcgLu6s/yp1S7tJWguYLrS5IZoyVZWXVLYggjFWdan/vMn/Ge3/wCT&#xA;6YqisVdirsVdirsVdirsVdirsVdirsVdirsVdirsVdirsVdirsVdirsVSa1/5TLVP+2dp/8Ayfvc&#xA;VYNp/o6L/wA5D69DGyw2et+WrfV9QJPFBPZXRtfUYn4R+6bc4qyny/L5f1LzJe69Za8uqyXcEcNj&#xA;aRTAwQWsdC7RRqxDmWU8mlpuOKjYbqovzJc3Nrpuv3NqxS6g0tpIHUVIkRZ2Ugb7gjFWC+WPLOkL&#xA;+T2j+ZrSD6v5lXQItSbWYdr2a6lsfUlaafeSb1HY8lcnt3Aoqhvy68s69ceSfJt3Y2+kWVs1vpOo&#xA;T6ohl/SMjMsM95zfgFZ7kmRHq2/I4qxfyP5Y0ZP+cfdS85mASeaLSLW9Ts9YkJe6gmsru5kjEMrV&#xA;eNGeHk6qaMS3IGpxVGfn3LLFp35lNG7IzaR5VRipIJWTWLxHU07MrEEdxirNYvJHkx/zCuNFbRLC&#xA;30i30q2vbfSorWGO2uriW4uIppZokVUmNskUQTmDw9UkbnFXjXmcJDB+demW11Jc6fpt35VtbCN5&#xA;GkEEYv8AmbeMkmixSOyBe1KYq+o9T/3mT/jPb/8AJ9MVSyTzLbWms6zFqd/p9ppel2tncPI83CWH&#xA;6w06u90ZOMUcbekoj3rs1e2KrtM88eStVjuZdL1/Tb+KzjMt5JbXcEywxjq8rI7BF92xVQ8rfoi5&#xA;vtU1ey1j9LS6m8cnESco7e3RfThjiiqeCHiz8qfGxJ6UoqyLFXYq7FXYq7FXYq7FXYq7FXYq7FXY&#xA;q7FXYq7FXYq7FXYqxK+80+WtE87Xses6raaY1zplnJB9cnjgDrDPd+oVMjLXj6i1+eKvG/OX1nzh&#xA;5f8AzP8AzDsY5W0ltJj0Ly5NxZWuLO1l9e8uFBofSeUnie4BxV69baZPc67oV/c+Zra6skkmvNF0&#xA;63t4ofVja2kiokiyOzxxxXHLYUrxOKsmmE0d5LKLdriOaKOMhCmxRnJ5B2TrzxVIdM8m+XdLnhks&#xA;tFuo47Zme0s2umktIGcEMYLSS5a3hNHYD00FATTqcVWaZ5H8s6ZcQzWOiXcUdrIZrSy+ts9lBIa/&#xA;HBZvctbRMORoUjFKmnXFUVHonl+w8tXOgLorW/l+4W5S4s2eERFL53edatNsJHmbYHatBTFUFN5P&#xA;8o6pBrX1jRptQh8wmIas0t164lFu5eFFZrlvSWJ2LIkXEKegxVNNa0ix1r0DfaZd+tbFjbXNtcfV&#xA;LiPnQOEntriKVVfiOShqN3xVKB+XXkoWd7aR+WpIoNS+qfXhFMI2lawnNzbO7pcK5dJmLl68mP2i&#xA;cVZBHBKLWGyitrhI45I29W5mEzUSUSHlI0ssrdNq1+7FXnt75aHmT8wfPuleuluzWvle5jlkiFxH&#xA;6lldXV0iyQlk9RGaEK68hUE74qx7849S8y2Ply/8uX+oadqVpNZpqM62Fm9nJbJYavpqyeqpuboG&#xA;N4bmQtVRQIeorir0rSNJvF822+oal5ih1O7TT7hLOxht44P9HuZrd2mJWSRnUNAqqem5xVluKuxV&#xA;2KuxV2KuxV2KuxV2KuxV2KuxVRu722tER7h+IkdY4wAWZnboFVQWO1SdtgCTsDiqsCCAQag7gjFX&#xA;Yq7FXYq7FUq1ryn5W114X1zRrHVXt6/V2vbaG4MddzwMqtxrTtiqZRwQxwrBHGqQooRIlAChQKBQ&#xA;o2pTtiqX6T5W8saPPNcaTpFlp1xcbTzWlvFA8gry+No1UtvvvirH9W8p+crvzwNXtPMUllov1L6u&#xA;lpGsbNDNzBLLHLFLHJ6ndiVZaUFQdlUd/hrzV/1N97/0i6f/ANk+Ku/w15q/6m+9/wCkXT/+yfFV&#xA;ax0nWLC7S61DV7jWYEVgsUkFuhidqD1VFvHGzHjVe/XFW7/S9Y1G8Nzp+rXOjwcFQqkEDGVlLEsy&#xA;3McjLSoA6V+VMVUP8Neav+pvvf8ApF0//snxV3+GvNX/AFN97/0i6f8A9k+KpfaeTvN8Pniy1qfz&#xA;NPdaVb2kkNzaSLEn1h3aqK0MUUcarH9r1Klz9nYdVWU3ei6PeC6F1YwTi+jSG99SJG9aKMsUjlqP&#xA;jRS7UVttz44qgdH8k+TNFeZ9G0DTtMe5T0rhrO0ggMkZ34OY0XkvscVROj+W/LuiLKujaXaaYs5D&#xA;TCzgitw5HQt6aryO/fFUxxV2KuxV2KuxV2KuxV2KuxV2KuxV2KsV8+NcTLpemx29u63V0JTc3QnZ&#xA;I3tB9YjVUtyjyPI0dOHMBl5V5CqlVk1q0z20LzKiTMimRI2LorEbhXITkoPQ8RXwxVUxV2KuxV2K&#xA;vmLVf+c0Y9P1S8sD5aMhtJ5IDIJwAxjcpWlDStMVQv8A0O/F/wBSw3/SQP8AmnFXf9Dvxf8AUsN/&#xA;0kD/AJpxV3/Q78X/AFLDf9JA/wCacVd/0O/F/wBSw3/SQP8AmnFXf9Dvxf8AUsN/0kD/AJpxV3/Q&#xA;78X/AFLDf9JA/wCacVd/0O/F/wBSw3/SQP8AmnFXf9Dvxf8AUsN/0kD/AJpxV3/Q78X/AFLDf9JA&#xA;/wCacVd/0O/F/wBSw3/SQP8AmnFXf9Dvxf8AUsN/0kD/AJpxV3/Q78X/AFLDf9JA/wCacVd/0O/F&#xA;/wBSw3/SQP8AmnFXpf5I/n0v5n6hqloulHThpsMcpYyepz9VitOgpTjir1zFXYq7FXYq7FXYq7FX&#xA;Yq7FXYq7FWHefdU1OzlRYbu5s7RLG9ulFmsXr3d1bhGhtI3ljnCsylmVVTk9NtlYFVkmjG7OnRC7&#xA;m+sTKXX6xRVMqK5VJCEotXQBjxFPDbFUbirsVdirsVfmP5gsry986apaWUElzdz6hcJBbwo0kjsZ&#xA;moqIoLMT4DFULrXlvzFoUqQ63pd5pc0gJjjvYJbdmA6kCVVJxVLcVRmlKpvPiVXCxTOFYBhySF2W&#xA;oNQaEYqrfX5v99wf9I8H/NGKu+vzf77g/wCkeD/mjFXfX5v99wf9I8H/ADRirOfy1/LbzT55e+ls&#xA;LOA2Flb3TNccLGKt1HayS28I9bhUPKqK5GyqakjrirFNatdV0XVbnStRhtEvbR/TuEiSznVWoCR6&#xA;kIkjald6NsduuKoH6/N/vuD/AKR4P+aMVZR590AeWrjREgeKePV9F07V/jtrfkj3kAeSPaMVAkDc&#xA;fanzxViGqKq3nwqFDRwuQoCjk8Ss1ANhucVQmKuxV9Nf84P/APHf81f8wlt/ycfFX11irsVdirsV&#xA;dirsVdirsVdirsVdirsVdirsVdirsVdir84LK8u7H8ytZvbOZ7e7tTrU1vPGSrxyR21yyOrDcFWF&#xA;QcVZd+VXmLV/PdnrP5beZLubVotTsrm88vSXbmaW11SziaeNopJCXVZERw6g7/SaqvMdF0/SLm21&#xA;O51O++qLZ2xezgRQ8tzcswSKJQSOK7l3fso8SMVQ+k/71t/xguP+TD4qzGTyx5Z0fyh5d13Wlvb6&#xA;bzGbqSGCzmitlt4LSc2xLNJDcmV3dWIHwgDxriqbw/lrpx8q2er6bbXnmKXWLu/isDC6Waw2dg8U&#xA;fqyq6ykyymcUXlRaH7WKo26/LjyXoXkrV9e15r24ntdVsLK1srWWKOX/AEnTjeSW8kxSaNXQy8Xf&#xA;0m3joFHLZVB+XNF07TvMP1vS3mbTNZ8p67f2aXJVpowNOv7aSOR0CK5Sa2cBgoqKGg6YqiPN35ce&#xA;T9J/MC48iWQvxd2kUVxda7c3ULW6QrYrf3U31NLVXpHDzovr9uuKobyl5F8jebrDzNc6ZNqOny+W&#xA;tIvdU+r3UkE5u1t4mMTq0cUQhpLx5xnnsdn2xVT/ADt/3p8lf+Afon/Jg4qwZtI1LVNRkhsIGnkt&#xA;7EXc4Wg4QW1oJppCSQKKiE+/Qb4qk+Kproun6Rc22p3Op331RbO2L2cCKHlublmCRRKCRxXcu79l&#xA;HiRir6F/5wf/AOO/5q/5hLb/AJOPir66xV2KuxV2KuxV2KuxV2KuxV2KuxV2KuxV2KuxV2KuxV+b&#xA;Q/5T/wAwf6muf9Ql1irIf+cck+rfmUnmCXaw8tafqGq38m1FijtZIxWu28kqjFUyu/IXlWzPlSwu&#xA;ZNMtNN1DTdN1HWtRvrtodQ5ahGJZngTmF4QJJSNfTIYr8XI4q8q0n/etv+MFx/yYfFWZHzN5Y1jy&#xA;foGg6617YzeXDdJbXFjBFdLPBdz/AFgq6yzW3pukjNRhyBB6bbqr280eUtW8oWHlrVhf6bHol5eX&#xA;Gk3drHDfM0F8Yy8NwjyWI5oYVIkVt9/gGKqN95x0Q/l7e+UNPtbmKN9dh1azmndJD6EdnLbMspUJ&#xA;8ZZlYcVp1HbdVFaL528v21haG7S7F7pnlzUtCtIoo43imn1KXUCZJJGkRo0jTUF6IxYg9OuKqvm3&#xA;8z7XVvzVuPOtpZP9Uu4Ybe606cgF4W05LC8i5py2kT1FVvAgkdsVRflHz15F8oad5mtdNh1HUZ/M&#xA;uk3mlm6uY4bc2i3ELBEVI5phNWUpzkJT4V2SppiqR/mD5q0fzImgTWbXKXGlaNp2kSwTQxolbK3C&#xA;SSLKs0hblJXjVF+H3xVvyTo+m6pruspfwidLTyzqN5ArEgLPb6UzxPsRujbj3xVkI8t6HfafpNh5&#xA;W8v+XtUvbyxsl+uXmtumoS6hPbxmeNbL6/aqrrcu8aJ6R5UHWuKq135C8q2Z8qWFzJplppuoabpu&#xA;o61qN9dtDqHLUIxLM8CcwvCBJKRr6ZDFfi5HFWcf84P/APHf81f8wlt/ycfFX11irsVdirsVdirs&#xA;VdirsVdirsVdirsVdirsVdirsVdir81zrlvof5lX2p3NiupWkN/eJdae7tEs8MzSRSxmRasvJHIq&#xA;OmKpp5g/M/SW8uXflvyZ5bj8q6VqjI+st9alv7u6ER5RxNcSqhSJTvwVdz361VQd7580bVrLSjru&#xA;htfavotjFptncx3ZhtpYLYFbf61biJ3kManjWOaPkAK4ql35eeXbXzH5z0rRbrVo9EgvZhG2pSkg&#xA;JsTRSKDm/wBlKkCp64qyfU/JENrqV3aj8xtIhEE0kQhuJtXEycHK8ZKWAHMUo1O+KoX/AAjF/wCX&#xA;L0P/AJHax/2Q4q7/AAjF/wCXL0P/AJHax/2Q4qkiXVxJrf6HN2YYjcG1OpNNc0RQ/D13ozfAv22o&#xA;nTFU7/wjF/5cvQ/+R2sf9kOKu/wjF/5cvQ/+R2sf9kOKpl5c/L+31PXtP0+T8xdKnju50heK0m1U&#xA;zkO1D6YksQnIdfiIHiR1xVIDqUfkbzj5js7W7h8wwyWmpaMNRhdljlW9t3t/XViGqU51I3BIoGpR&#xA;sVb8mebPJHlu+07V5PL9/qOuaZNFd287anHDa/WIHEkbfV1s2k4q6iqmbf2xV17580bVrLSjruht&#xA;favotjFptncx3ZhtpYLYFbf61biJ3kManjWOaPkAK4q9m/5wf/47/mr/AJhLb/k4+KvrrFXYq7FX&#xA;Yq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FX55+Zfya/NafzHqs8PlPVJIZby4eKRbWQqytKxUg06&#xA;EYqln/KlPzc/6lDVf+kWX+mKu/5Up+bn/Uoar/0iy/0xV3/KlPzc/wCpQ1X/AKRZf6Yq7/lSn5uf&#xA;9Shqv/SLL/TFXf8AKlPzc/6lDVf+kWX+mKu/5Up+bn/Uoar/ANIsv9MVRB/KL85jD6R8qatxoFr9&#xA;UfkVHRC/HkV/ya0xVD/8qU/Nz/qUNV/6RZf6Yq7/AJUp+bn/AFKGq/8ASLL/AExV3/KlPzc/6lDV&#xA;f+kWX+mKu/5Up+bn/Uoar/0iy/0xV3/KlPzc/wCpQ1X/AKRZf6Yq7/lSn5uf9Shqv/SLL/TFX0F/&#xA;ziF5E85eWda8xy+YNFvNKiuba3SB7uFog7LI5YLyArSuKvp3FXYq7FXYq7FXYq7FXYq7FXYq7FXY&#xA;q7FXYq7FXYq7FX//2Q==</xmpGImg:image>
- </rdf:li>
- </rdf:Alt>
- </xmp:Thumbnails>
- </rdf:Description>
- <rdf:Description rdf:about=""
- xmlns:xmpMM="http://ns.adobe.com/xap/1.0/mm/"
- xmlns:stRef="http://ns.adobe.com/xap/1.0/sType/ResourceRef#"
- xmlns:stEvt="http://ns.adobe.com/xap/1.0/sType/ResourceEvent#">
- <xmpMM:OriginalDocumentID>uuid:AF0436EA903B11DB90DFD5CCDBF73423</xmpMM:OriginalDocumentID>
- <xmpMM:DocumentID>xmp.did:0180117407206811822AA5DFA83DBEE8</xmpMM:DocumentID>
- <xmpMM:InstanceID>uuid:a78d6ca4-ee25-5f4f-9857-efe87b47a9ff</xmpMM:InstanceID>
- <xmpMM:RenditionClass>proof:pdf</xmpMM:RenditionClass>
- <xmpMM:DerivedFrom rdf:parseType="Resource">
- <stRef:instanceID>uuid:d0c80ddf-8d24-9c4a-b5a2-f5403c78eac7</stRef:instanceID>
- <stRef:documentID>xmp.did:F87F11740720681183D1ECDDA24ACDE7</stRef:documentID>
- <stRef:originalDocumentID>uuid:AF0436EA903B11DB90DFD5CCDBF73423</stRef:originalDocumentID>
- <stRef:renditionClass>proof:pdf</stRef:renditionClass>
- </xmpMM:DerivedFrom>
- <xmpMM:History>
- <rdf:Seq>
- <rdf:li rdf:parseType="Resource">
- <stEvt:action>saved</stEvt:action>
- <stEvt:instanceID>xmp.iid:0380117407206811822AABA902D116C4</stEvt:instanceID>
- <stEvt:when>2014-09-11T14:30:24+02:00</stEvt:when>
- <stEvt:softwareAgent>Adobe Illustrator CS6 (Macintosh)</stEvt:softwareAgent>
- <stEvt:changed>/</stEvt:changed>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <stEvt:action>saved</stEvt:action>
- <stEvt:instanceID>xmp.iid:0180117407206811822AA5DFA83DBEE8</stEvt:instanceID>
- <stEvt:when>2014-09-16T12:36:28+02:00</stEvt:when>
- <stEvt:softwareAgent>Adobe Illustrator CS6 (Macintosh)</stEvt:softwareAgent>
- <stEvt:changed>/</stEvt:changed>
- </rdf:li>
- </rdf:Seq>
- </xmpMM:History>
- </rdf:Description>
- <rdf:Description rdf:about=""
- xmlns:illustrator="http://ns.adobe.com/illustrator/1.0/">
- <illustrator:StartupProfile>Video</illustrator:StartupProfile>
- <illustrator:Type>Document</illustrator:Type>
- </rdf:Description>
- <rdf:Description rdf:about=""
- xmlns:xmpTPg="http://ns.adobe.com/xap/1.0/t/pg/"
- xmlns:stDim="http://ns.adobe.com/xap/1.0/sType/Dimensions#"
- xmlns:stFnt="http://ns.adobe.com/xap/1.0/sType/Font#"
- xmlns:xmpG="http://ns.adobe.com/xap/1.0/g/">
- <xmpTPg:NPages>1</xmpTPg:NPages>
- <xmpTPg:HasVisibleTransparency>True</xmpTPg:HasVisibleTransparency>
- <xmpTPg:HasVisibleOverprint>False</xmpTPg:HasVisibleOverprint>
- <xmpTPg:MaxPageSize rdf:parseType="Resource">
- <stDim:w>1920.000000</stDim:w>
- <stDim:h>1080.000000</stDim:h>
- <stDim:unit>Pixels</stDim:unit>
- </xmpTPg:MaxPageSize>
- <xmpTPg:Fonts>
- <rdf:Bag>
- <rdf:li rdf:parseType="Resource">
- <stFnt:fontName>OldNewspaperTypes</stFnt:fontName>
- <stFnt:fontFamily>OldNewspaperTypes</stFnt:fontFamily>
- <stFnt:fontFace>Regular</stFnt:fontFace>
- <stFnt:fontType>TrueType</stFnt:fontType>
- <stFnt:versionString>1.0 2007-02-14</stFnt:versionString>
- <stFnt:composite>False</stFnt:composite>
- <stFnt:fontFileName>OldNewspaperTypes.ttf</stFnt:fontFileName>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <stFnt:fontName>Perpetua</stFnt:fontName>
- <stFnt:fontFamily>Perpetua</stFnt:fontFamily>
- <stFnt:fontFace>Regular</stFnt:fontFace>
- <stFnt:fontType>Open Type</stFnt:fontType>
- <stFnt:versionString>Version 1.76</stFnt:versionString>
- <stFnt:composite>False</stFnt:composite>
- <stFnt:fontFileName>Perpetua.ttf</stFnt:fontFileName>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <stFnt:fontName>SmothBight</stFnt:fontName>
- <stFnt:fontFamily>Smoth Bight</stFnt:fontFamily>
- <stFnt:fontFace>Regular</stFnt:fontFace>
- <stFnt:fontType>Open Type</stFnt:fontType>
- <stFnt:versionString>Version 1.00 (Kustren)</stFnt:versionString>
- <stFnt:composite>False</stFnt:composite>
- <stFnt:fontFileName>Smoth-Bight - Por Kustren.otf</stFnt:fontFileName>
- </rdf:li>
- </rdf:Bag>
- </xmpTPg:Fonts>
- <xmpTPg:PlateNames>
- <rdf:Seq>
- <rdf:li>Cyan</rdf:li>
- <rdf:li>Magenta</rdf:li>
- <rdf:li>Yellow</rdf:li>
- <rdf:li>Black</rdf:li>
- </rdf:Seq>
- </xmpTPg:PlateNames>
- <xmpTPg:SwatchGroups>
- <rdf:Seq>
- <rdf:li rdf:parseType="Resource">
- <xmpG:groupName>Groupe de nuances par défaut</xmpG:groupName>
- <xmpG:groupType>0</xmpG:groupType>
- <xmpG:Colorants>
- <rdf:Seq>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>Blanc</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>255</xmpG:red>
- <xmpG:green>255</xmpG:green>
- <xmpG:blue>255</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>Noir</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>0</xmpG:red>
- <xmpG:green>0</xmpG:green>
- <xmpG:blue>0</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>Rouge RVB</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>255</xmpG:red>
- <xmpG:green>0</xmpG:green>
- <xmpG:blue>0</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>Jaune RVB</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>255</xmpG:red>
- <xmpG:green>255</xmpG:green>
- <xmpG:blue>0</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>Vert RVB</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>0</xmpG:red>
- <xmpG:green>255</xmpG:green>
- <xmpG:blue>0</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>Cyan RVB</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>0</xmpG:red>
- <xmpG:green>255</xmpG:green>
- <xmpG:blue>255</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>Bleu RVB</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>0</xmpG:red>
- <xmpG:green>0</xmpG:green>
- <xmpG:blue>255</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>Magenta RVB</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>255</xmpG:red>
- <xmpG:green>0</xmpG:green>
- <xmpG:blue>255</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=193 V=39 B=45</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>193</xmpG:red>
- <xmpG:green>39</xmpG:green>
- <xmpG:blue>45</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=237 V=28 B=36</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>237</xmpG:red>
- <xmpG:green>28</xmpG:green>
- <xmpG:blue>36</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=241 V=90 B=36</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>241</xmpG:red>
- <xmpG:green>90</xmpG:green>
- <xmpG:blue>36</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=247 V=147 B=30</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>247</xmpG:red>
- <xmpG:green>147</xmpG:green>
- <xmpG:blue>30</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=251 V=176 B=59</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>251</xmpG:red>
- <xmpG:green>176</xmpG:green>
- <xmpG:blue>59</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=252 V=238 B=33</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>252</xmpG:red>
- <xmpG:green>238</xmpG:green>
- <xmpG:blue>33</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=217 V=224 B=33</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>217</xmpG:red>
- <xmpG:green>224</xmpG:green>
- <xmpG:blue>33</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=140 V=198 B=63</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>140</xmpG:red>
- <xmpG:green>198</xmpG:green>
- <xmpG:blue>63</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=57 V=181 B=74</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>57</xmpG:red>
- <xmpG:green>181</xmpG:green>
- <xmpG:blue>74</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=0 V=146 B=69</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>0</xmpG:red>
- <xmpG:green>146</xmpG:green>
- <xmpG:blue>69</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=0 V=104 B=55</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>0</xmpG:red>
- <xmpG:green>104</xmpG:green>
- <xmpG:blue>55</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=34 V=181 B=115</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>34</xmpG:red>
- <xmpG:green>181</xmpG:green>
- <xmpG:blue>115</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=0 V=69 B=157</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>0</xmpG:red>
- <xmpG:green>169</xmpG:green>
- <xmpG:blue>157</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=41 V=71 B=226</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>41</xmpG:red>
- <xmpG:green>171</xmpG:green>
- <xmpG:blue>226</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=0 V=113 B=188</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>0</xmpG:red>
- <xmpG:green>113</xmpG:green>
- <xmpG:blue>188</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=46 V=49 B=146</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>46</xmpG:red>
- <xmpG:green>49</xmpG:green>
- <xmpG:blue>146</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=27 V=20 B=100</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>27</xmpG:red>
- <xmpG:green>20</xmpG:green>
- <xmpG:blue>100</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=102 V=45 B=145</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>102</xmpG:red>
- <xmpG:green>45</xmpG:green>
- <xmpG:blue>145</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=147 V=39 B=143</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>147</xmpG:red>
- <xmpG:green>39</xmpG:green>
- <xmpG:blue>143</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=158 V=0 B=93</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>158</xmpG:red>
- <xmpG:green>0</xmpG:green>
- <xmpG:blue>93</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=212 V=20 B=90</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>212</xmpG:red>
- <xmpG:green>20</xmpG:green>
- <xmpG:blue>90</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=237 V=30 B=121</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>237</xmpG:red>
- <xmpG:green>30</xmpG:green>
- <xmpG:blue>121</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=199 V=178 B=153</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>199</xmpG:red>
- <xmpG:green>178</xmpG:green>
- <xmpG:blue>153</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=153 V=134 B=117</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>153</xmpG:red>
- <xmpG:green>134</xmpG:green>
- <xmpG:blue>117</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=115 V=99 B=87</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>115</xmpG:red>
- <xmpG:green>99</xmpG:green>
- <xmpG:blue>87</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=83 V=71 B=65</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>83</xmpG:red>
- <xmpG:green>71</xmpG:green>
- <xmpG:blue>65</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=198 V=156 B=109</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>198</xmpG:red>
- <xmpG:green>156</xmpG:green>
- <xmpG:blue>109</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=166 V=124 B=82</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>166</xmpG:red>
- <xmpG:green>124</xmpG:green>
- <xmpG:blue>82</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=140 V=98 B=57</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>140</xmpG:red>
- <xmpG:green>98</xmpG:green>
- <xmpG:blue>57</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=117 V=76 B=36</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>117</xmpG:red>
- <xmpG:green>76</xmpG:green>
- <xmpG:blue>36</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=96 V=56 B=19</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>96</xmpG:red>
- <xmpG:green>56</xmpG:green>
- <xmpG:blue>19</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=66 V=33 B=11</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>66</xmpG:red>
- <xmpG:green>33</xmpG:green>
- <xmpG:blue>11</xmpG:blue>
- </rdf:li>
- </rdf:Seq>
- </xmpG:Colorants>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:groupName>Gris</xmpG:groupName>
- <xmpG:groupType>1</xmpG:groupType>
- <xmpG:Colorants>
- <rdf:Seq>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=0 V=0 B=0</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>0</xmpG:red>
- <xmpG:green>0</xmpG:green>
- <xmpG:blue>0</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=26 V=26 B=26</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>26</xmpG:red>
- <xmpG:green>26</xmpG:green>
- <xmpG:blue>26</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=51 V=51 B=51</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>51</xmpG:red>
- <xmpG:green>51</xmpG:green>
- <xmpG:blue>51</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=77 V=77 B=77</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>77</xmpG:red>
- <xmpG:green>77</xmpG:green>
- <xmpG:blue>77</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=102 V=102 B=102</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>102</xmpG:red>
- <xmpG:green>102</xmpG:green>
- <xmpG:blue>102</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=128 V=128 B=128</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>128</xmpG:red>
- <xmpG:green>128</xmpG:green>
- <xmpG:blue>128</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=153 V=153 B=153</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>153</xmpG:red>
- <xmpG:green>153</xmpG:green>
- <xmpG:blue>153</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=179 V=179 B=179</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>179</xmpG:red>
- <xmpG:green>179</xmpG:green>
- <xmpG:blue>179</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=204 V=204 B=204</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>204</xmpG:red>
- <xmpG:green>204</xmpG:green>
- <xmpG:blue>204</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=230 V=230 B=230</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>230</xmpG:red>
- <xmpG:green>230</xmpG:green>
- <xmpG:blue>230</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=242 V=242 B=242</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>242</xmpG:red>
- <xmpG:green>242</xmpG:green>
- <xmpG:blue>242</xmpG:blue>
- </rdf:li>
- </rdf:Seq>
- </xmpG:Colorants>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:groupName>Groupe de couleurs pour films et vidéos</xmpG:groupName>
- <xmpG:groupType>1</xmpG:groupType>
- <xmpG:Colorants>
- <rdf:Seq>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=123 V=112 B=49</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>123</xmpG:red>
- <xmpG:green>112</xmpG:green>
- <xmpG:blue>49</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=199 V=163 B=21</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>199</xmpG:red>
- <xmpG:green>163</xmpG:green>
- <xmpG:blue>21</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=182 V=165 B=85</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>182</xmpG:red>
- <xmpG:green>165</xmpG:green>
- <xmpG:blue>85</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=235 V=208 B=101</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>235</xmpG:red>
- <xmpG:green>208</xmpG:green>
- <xmpG:blue>101</xmpG:blue>
- </rdf:li>
- <rdf:li rdf:parseType="Resource">
- <xmpG:swatchName>R=122 V=111 B=185</xmpG:swatchName>
- <xmpG:mode>RGB</xmpG:mode>
- <xmpG:type>PROCESS</xmpG:type>
- <xmpG:red>122</xmpG:red>
- <xmpG:green>111</xmpG:green>
- <xmpG:blue>185</xmpG:blue>
- </rdf:li>
- </rdf:Seq>
- </xmpG:Colorants>
- </rdf:li>
- </rdf:Seq>
- </xmpTPg:SwatchGroups>
- </rdf:Description>
- <rdf:Description rdf:about=""
- xmlns:pdf="http://ns.adobe.com/pdf/1.3/">
- <pdf:Producer>Adobe PDF library 10.01</pdf:Producer>
- </rdf:Description>
- </rdf:RDF>
-</x:xmpmeta>
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-<?xpacket end="w"?> endstream endobj 3 0 obj <</Count 2/Kids[7 0 R 8 0 R]/Type/Pages>> endobj 7 0 obj <</ArtBox[224.515 66.2373 1617.31 1080.0]/BleedBox[0.0 0.0 1920.0 1080.0]/Contents 732 0 R/Group 733 0 R/LastModified(D:20140918115258+02'00')/MediaBox[0.0 0.0 1920.0 1080.0]/Parent 3 0 R/PieceInfo<</Illustrator 734 0 R>>/Resources<</ColorSpace<</CS0 735 0 R/CS1 736 0 R/CS2 737 0 R/CS3 738 0 R/CS4 739 0 R/CS5 740 0 R/CS6 741 0 R/CS7 742 0 R/CS8 743 0 R>>/ExtGState<</GS0 744 0 R/GS1 745 0 R/GS2 746 0 R/GS3 747 0 R/GS4 748 0 R/GS5 749 0 R/GS6 750 0 R/GS7 751 0 R>>/Font<</T1_0 752 0 R/TT0 753 0 R/TT1 754 0 R>>/ProcSet[/PDF/Text/ImageC/ImageI]/Properties<</MC0 730 0 R>>/Shading<</Sh0 755 0 R>>/XObject<</Fm0 756 0 R/Fm1 757 0 R/Fm2 758 0 R/Fm3 759 0 R/Fm4 760 0 R/Fm5 761 0 R/Fm6 762 0 R/Im0 763 0 R/Im1 764 0 R/Im2 765 0 R/Im3 766 0 R/Im4 763 0 R/Im5 767 0 R/Im6 768 0 R/Im7 769 0 R/Im8 770 0 R/Im9 771 0 R>>>>/TrimBox[0.0 0.0 1920.0 1080.0]/Type/Page>> endobj 8 0 obj <</ArtBox[6464.01 6726.74 7856.81 7766.5]/BleedBox[0.0 0.0 14400.0 14400.0]/Contents 772 0 R/Group 773 0 R/LastModified(D:20140918115258+02'00')/MediaBox[0.0 0.0 14400.0 14400.0]/Parent 3 0 R/PieceInfo<</Illustrator 734 0 R>>/Resources<</ColorSpace<</CS0 735 0 R/CS1 736 0 R/CS2 737 0 R/CS3 738 0 R/CS4 739 0 R/CS5 740 0 R/CS6 741 0 R/CS7 742 0 R/CS8 743 0 R>>/ExtGState<</GS0 744 0 R/GS1 745 0 R/GS2 774 0 R/GS3 747 0 R/GS4 775 0 R/GS5 776 0 R/GS6 777 0 R/GS7 778 0 R>>/Font<</T1_0 752 0 R/TT0 753 0 R/TT1 754 0 R>>/ProcSet[/PDF/Text/ImageC/ImageI]/Properties<</MC0 730 0 R>>/Shading<</Sh0 755 0 R>>/XObject<</Fm0 779 0 R/Fm1 780 0 R/Fm2 781 0 R/Fm3 782 0 R/Fm4 783 0 R/Fm5 784 0 R/Fm6 785 0 R/Im0 763 0 R/Im1 764 0 R/Im2 765 0 R/Im3 766 0 R/Im4 763 0 R/Im5 767 0 R/Im6 768 0 R/Im7 769 0 R/Im8 770 0 R/Im9 771 0 R>>>>/TrimBox[0.0 0.0 14400.0 14400.0]/Type/Page>> endobj 772 0 obj <</Filter/FlateDecode/Length 3434>>stream
-Hԗ[o%WWiqA`K\Ϸt&y
-sNuWZU7޽MW7]߸`)ΡG->ٻ1૫-N5eS[7ɻ?-<`O? {W?ӯTKD]%%5w璛5yZDⓜcε\v7
-_:Z{:.`nQ,6fE-Msx,/51*1y2B
-w:
-cqb;O/_=w^
-?zaaLfҜ{8e8!W,!?PO9y L뗸K)<oJaj:H.?mX
-貟+'PU#om%9(4)uH# +S"/|]yx2zRy3Ѱ\C[rƴ)7չFVC;u6-;: Ҫm
-
-χ!LzD[HK߬H!
-+1Cɐ*-<5&]a5/,
-4>/c,k y3Ez{ՄMIiE6޺-p] N+N!:HF,RC,)!U]aW :V g;+WtHu<j8%ےbTţ KZ0EgA ] ),2IۄÝ :9QuIaB^a`X;*-nmw
-__)δ TY^ &vypJOSҟNI)߷G񿻹|vܷn`&k &75Ћ,,ۃ6/+D`X3욹5i:0BH6'53R'Y⋻Otw6^hӋOqܖ }g]]xw~pQ=-yyTY CֳĠp yと.n Fͩ q>w`u߾ު/3 wƒnIrūF:O WGWNgh=活{z7o o5Qp;|B̭{ 4tV]Z.ytP߀z
-wH.lO^_^7[)@#IKuxZv䒪w˥ǵ IbeߍuhO?5%mo
-9 XϜǽ
-ym$1ڽ"dJ~#w2J +nn)|ѐʟ PDoO$ lOpsfnBHexWumDѧ.nWMe#ɭcx=OAA<be՜OBI<WBj1VTqP)l6j2_[zUpv!
-2$?ܦEʰ(=DE84fd|WuKs8deZ};bf ),G#+2OJ}u)vonR QX; N"IŒRJ!=:hj @jua2j;.5A7JO^Uؾ\[jp_)K
- ",p2U? G cAlp^0lw9U4^Kel.Fh)O|#}[tg{(NƹN6.U1Y*j+~e"#z-+VB taψ;/hqHA#+q=uaO"pְd#6P|9XhVY&`ٺ\#ž/$rː*fJO~j~>`U4T OIZĶ8|%]2(.%.c
-q
-/GS0 gs
-486 0 0 480 6513.1162109 7207.1401367 cm
-/Im0 Do
-Q
- endstream endobj 780 0 obj <</BBox[6557.12 7644.14 6955.12 7246.14]/Group 791 0 R/Length 61/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ColorSpace<</CS0 788 0 R>>/ExtGState<</GS0 792 0 R>>/ProcSet[/PDF/ImageC/ImageI]/XObject<</Im0 793 0 R>>>>/Subtype/Form>>stream
-q
-/GS0 gs
-398 0 0 398 6557.1162109 7246.1401367 cm
-/Im0 Do
-Q
- endstream endobj 781 0 obj <</BBox[6625.12 7519.14 6893.12 7475.14]/Group 794 0 R/Length 60/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ColorSpace<</CS0 788 0 R>>/ExtGState<</GS0 795 0 R>>/ProcSet[/PDF/ImageC/ImageI]/XObject<</Im0 796 0 R>>>>/Subtype/Form>>stream
-q
-/GS0 gs
-268 0 0 44 6625.1162109 7475.1401367 cm
-/Im0 Do
-Q
- endstream endobj 782 0 obj <</BBox[6622.12 7549.14 6896.12 7246.14]/Group 797 0 R/Length 61/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ColorSpace<</CS0 788 0 R>>/ExtGState<</GS0 798 0 R>>/ProcSet[/PDF/ImageC/ImageI]/XObject<</Im0 799 0 R>>>>/Subtype/Form>>stream
-q
-/GS0 gs
-274 0 0 303 6622.1162109 7246.1401367 cm
-/Im0 Do
-Q
- endstream endobj 783 0 obj <</BBox[6647.5 7607.5 6943.5 7516.5]/Group 800 0 R/Length 48/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ColorSpace<</CS0 788 0 R>>/ExtGState<</GS0 801 0 R>>/ProcSet[/PDF/ImageC/ImageI]/XObject<</Im0 802 0 R>>>>/Subtype/Form>>stream
-q
-/GS0 gs
-296 0 0 91 6647.5 7516.5 cm
-/Im0 Do
-Q
- endstream endobj 784 0 obj <</BBox[6485.5 7766.5 6957.5 7240.5]/Group 803 0 R/Length 49/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ColorSpace<</CS0 788 0 R>>/ExtGState<</GS0 804 0 R>>/ProcSet[/PDF/ImageC/ImageI]/XObject<</Im0 805 0 R>>>>/Subtype/Form>>stream
-q
-/GS0 gs
-472 0 0 526 6485.5 7240.5 cm
-/Im0 Do
-Q
- endstream endobj 785 0 obj <</BBox[6522.5 7682.5 7035.5 7180.5]/Group 806 0 R/Length 49/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ColorSpace<</CS0 788 0 R>>/ExtGState<</GS0 807 0 R>>/ProcSet[/PDF/ImageC/ImageI]/XObject<</Im0 808 0 R>>>>/Subtype/Form>>stream
-q
-/GS0 gs
-513 0 0 502 6522.5 7180.5 cm
-/Im0 Do
-Q
- endstream endobj 763 0 obj <</BitsPerComponent 8/ColorSpace 736 0 R/Decode[0.0 255.0]/Filter/FlateDecode/Height 87/Intent/RelativeColorimetric/Length 321/Name/X/SMask 809 0 R/Subtype/Image/Type/XObject/Width 310>>stream
-HgN@@uޝad"xVzj
-slBXiniYBru\(N[m.LCN~ݬ_֛n840-!+b-7NӴIEWLn5ql_l˯6t^QETPc`PO՞诪
-Hg{Jc6'9 Lw
-jH!T2#Wu\dt3           }? ^ؽ>{}`s3fz~p?xxv/^zkZ욣f(uP6ʲ$vf~{iv] N 0Ʒ)v8XL c<麆RPQd$ <q,0>Mӽ^ ˋfXTW3
-c>vڭf^Vʥb!fJ&s$>yƓTb;'gL]7JY*GA(x"t&rZ7v"BUSjz9w,$Pcˋ|x;.n *opԙ/NsXүRD,^_~ݿ?/..>]=>4l{S7`yHʕj+ϝ'GGD4SժL*y|-U`58;cM+phSu4uQÞ>YܝjLJC CC2ߴ!_ FSkTMgOofb#M{?-3-lmd8 M;)*S쾬4Fl}O1n>w~KƟeaX{Zw~=ې)'Vv?!t١ F= !5ʕ[ 'Ṿ-ڈ5Ն͊N$Lef{
-=kr\y=]<;15FtDn׳&
-NC1޴rcӳмl v'y%vr^XF@/؝Smh_>_f ܳ7 7Բw嬽f#zϗ?myKVDD[z v"wv,&n@6}r_ϴ;h!;,Uv_Y1*C7X wj"+Do^:k 휩c9/YGAv''Ʀ=`;1;Ұ$JDO!"v]r =UX3 vY6r@ zC͘ 얳)XnWoq{N*9ާMcv4rDOLgvHXeX')>lVDE,'ʚv/tۆ& XO9:Y* ݣ@R
-;ͦc^Gxq8B<;ۍrNq``皺<`\!z@LV<ڭ6cxY8`h7$Zsj]m"KcfIhVvCaFAz.+~kuvvӑ,Wֈ^e}
-vv˩.s6VD$m
-F`G;[/\ʧ/;:ۀYG;S+\*"zb͂]LeB%I-T[vL`D<A2Jvvvٰ,X.tܠ;эRŢ1^T] QGe]VHs҅jSSI, G^Wڲ vڕr^X/A- [;rMʼnܓO/ʖ:5Kd ==>X2Sl]-5D=^4.Ekvg*B!5 vky*rD/rUa
-va\*J}zT^hgj6rwwD/T`e',w{sK"4ؽn:G,w=T7`wb|1{_OX5{xJ܂i.x>]}"zI{JH]]^P$Qd' ; %X>`BvixnN%k8\noww Iq/>0٭Ozk\0˥!" ESYihx&#AzD/Ifh7e
-rzYXi턍- ꈞŎv VJ1 rZmhq xYM QkɊvNQrj-HavS)UD`F;X结Be҃R$zz+_ܢ1;rN]g1v 'ɉ oЎ߸dRӠxCB.ЫAN*=q;I$DOvvO7٠]9+S,Sx#v&`Anfzɵ6uvxvNniv=^~Frl'X}ts
-ܯ1=AYRѓ-ػ쿠/'ON>lhwߠ)J2ӛT;{Cv#߾_b{eRαtCo_X9ɛ\Ўߤ+WVKr#ܗ/oVa$g%fej響/h VN51g8
-X[bJ(z r{Pvȹ=^_=^n舟x@<^}D=RT vbmӱ"zDctmv]<@qz G8ډ5idz ‰t}]6 r@0̠HCf. r`(6vn"ӱp0H8`(sh'kzUP@.|s
-턁]1àrH4.HCv)E"rh,)N1T<=l Dz;grt"=ti_?A;~`Wx@.Hykdw{P)S\"J7h' L%StXA;v/wGRN@R4-Un"34M15x3(Nt&nNg,4\:-Kh7Ҫs \&+Vw/h'[mWKl@.˗lhzY1\qr|W;h7gPg<\Pdkh7dcQ.
-rbXXܣ0nsYaEb47n]tkUeJ%T[K'h'^i #rL^BɆvoze
-×{s{a;LwHj| u4({U[^^׷b:%kr
-=ȽO;ͥTct=ȽNz6~G`Wy' 7O曣T{b:Crt={աzLg˝bj"Gۯ) 7W{Վh';^fЃlX4'{]YЃ|u'{iZ,r=n\.Me^.jS /Tc߬VЃj٫N
-vvخЃz=hV@;. lvw ;.r~䶻pB=.yavb8QN;Ʈ=S=ЃpTM7*h';N w84ˋi'ؕI`=OnqI;. C=N=Ui@r Zek
-=ȩn!<4AN ˋJ:}uAN7 ۏvR[]āc^'gN紓kE8j g+7=ڕiڦ =ș "ϱ,Aβ/JK5v1cЃ8NYNOrYE;9q Vr}iܽ=$]zs=?L4].σ<?Ң\k1Cr~@oH0A.=Qhvbh#A.# ډM0(SA:"Nh;]i=E1#̒8ʺ9ivbhSA.NRaw\gWi@rI@8R,A.
- ˧ fv7uvug==e
- Է+T,/h7Xy=nchˢSA,]?؉?A zʪꦂvzv:7]uӃ\UwSA~]7;˹5~diׯgwE{.W vٹڣ]٥vpk7~qTn|ۏ~qTyyyc1c1c1c1c1cO
-HI
-Hҹ0Plc@ P
-kku.`A| i
-H{_t:if3q ."&"?#i~oaaaaaaaaaaa/Cv/^ڽ<{yyo~?۷ݒ?h;r߱Kfٜ|;^l.zɕ9I}K҂dsE2M˴z2c"^جWK{nNHO۶%Η9c|wnvϳ!*\LӦxe4e$!DZ`0>Mӽ^̀$U3=swZ΍",|9@aA/HQ'iA=AvO;Z)eDDrӽnj6j\*l&MQd"F"ch,r@z2~֎tAᇇAQdҙl._(ʕjhڝnϹ=,7*Xn6a]/&v(rۛϟ>^~_]8Z-ܯPx,t?|/.>\~.t)̩bu{U=3^a9Hʕj+^>O/O%br|"_Jydpk}|MjctX(Vf-,'6TH% }|@SɴǑUW\{\9w]iLSt2ɞš
-4U[s^suQve[nwDm|7-aWl)/ى
-f)€f zi|݈gz ר7@ 婉vvT WA礉vvDժ5Ь4Fvkc,6U+UkNWArrZ]F@N`:M+ʠyezBv3 W*@Ѧ# VhH W,Aq2\YB
-E#QKtKjJ\$$E |vJJΥV9{r^<)55K#=?c2]l]@;KlӉ݇A/
-uܠy]@ţ  ^4NkhNށ^1 vT̓blmLMF ws}zh"SeH<vAa%߃+л?R%V_y`G=C g chю+S;=DSŁ~B.A>Dvk-%#p z7pVhw%w ]߅hC8`vד䜳D"#298"mU#շ30qp,o_X`KEC녢,ډշ{id Q^
-Dv]&@8F;vt<9zPn^tNo @r/E;jL4˹.^/IU6λh'is:Gh'Z߮{Ye>
-vQPv! rvtD^Tj=Hkgh7o gXAMNrul=gW_No8Al2Ch56A g2@c_wh'le9zvvqv/glr@Π7On!;:=Yh'^J)[@NՁNnn!;-mh'tXM Qk@dumkb9J zF ډ=ߞ,"nTJ̮Pn}v†LzS*7x=b>2@N!W f珯Nа29i h'^ 9 Ie;#kN rY)nB|6Ы@nvfT:?:<hvJ=%Mh`w4 u
-LBk1kNJ$?%'G qvVoA4Vi_;^vٽ>vϪ܏?@OЩeF#r߿}'zh7~-j}IfUf*YٽHB/_zhqv˽z6f9ܗ_z=ɛ\<q;NϜg=n-I3ܧO^oZa+h7ݧ>[_.v Q1M"x+oG;AFow]{ r OSwEͳ;x~<>ُ=^7ڢJ8^_̪T{E;AB?z}Mo9h2>F6 ~Jj Hv.'F;ߦ̀i4ؿz|EFfgywYgt}4 u
-T*|LvFd2)#r2&4;z\zDN.WtS)G
-M{i/BNZ="T@f FӨTGT* Mow^̇]FZ zDN1ڍ5lh@i4:#ډ׳|{TMzV7B3 3t:#r:vqv/wŨbAF;_lߢ!;`
-Pn vvArs<t
-b: AȅS@;vsL2DbtyB;a`fSh\4OeJh'ֻ<cX,d^ rIG$C;v7 B:HK$R|yn턁]aI#r$)TNbeR)#r-Vn<4Εj h'һRgdl}"vr!NKv" +J1ɀdrrsչj)͂fJkD۽޵kl!r[[=FB-G"[_C;v'rP
-˂cJ}ne"vk j zD\6WwN]lo}YT@U*ڍE7Zj\Zo-ݿrJsRΉ`n]w*SO!%^^:Vm4(NqN-ﯯGrV]Hcin AdgV;h밓q=|}|gnXk|2ɍFhewlHn<.6'3`7luM&GrlU,a:tj>MNa'\^fGrbלv8n9|t7^k{iZ,XhN[/Grzw2ݠ. ,uYXV^1}IjRakzz$^o$v~m6Gr"ݰ. ]nYIwDz \S9vGrA10ݰ%<S=GrQ5vZ"-t8'v.uxd=;vZ2NGrjd]*\SS#9ELG$vZ* ]SWU#9UMWVYYiaaZnXgۦi{QV]a78pL`=3 a'awX鱜iAװڝDiə트oDvezeY㉤8nXgmٶi ;Iݥ8Gri9b==s=ь 솱] uY\q֮ư{N ^y^9duvi$|HEzsЊ `= v%%C#9͘$km$둜QъȮIGra%Y;Y]QrQ)X>
-IRfI#8Ɋvخiqή$a=K4vO]Y#4+*Ic˗;I]]YO䲼1 vEeYQְvͰ(H.ϋ
-vsЖEO䊲͎Haw$k>xU#a'ܧ`T\UUv:빮zz$ea'o`ܧv\7~[£vO쮗s}5]vOݟ:S vvWqۣSu.iVwy7Ͽ}ڿ?oo;B!B!B!B!B!
-H 
-H 0Qְ+Qs@+`䓋
-vG_
-H΁@
-H z--JRMX49jV&""""""ڟŇSrM'crfG
-'3ݞ<SSvA[*^HL+{,[Uw;лƔ0WL9E@}S T&"""""
-Hͱ
-tttlllfffaaaZZZTTTOOOJJJDDD???;;;555222---)))!!! 
-HyTSwoɞc [5laQIBHADED2mtFOE.c}08׎8GNg9w߽
- 
-V)gB0iW8#8wթ8_٥ʨQQj@&A)/g>'K
-x-
-ꇆnQt}MA0alSx k&^>0|>_',G!"F$H:R!zFQd?r 9\A&G rQ hE]a4zBgE#H *B=0HIpp0MxJ$D1D, VĭKĻYdE"EI2EBGt4MzNr!YK ?%_&#(0J:EAiQ(()ӔWT6U@P+!~mD eԴ!hӦh/']B/ҏӿ?a0nhF!X8܌kc&5S6lIa2cKMA!E#ƒdV(kel }}Cq9
-N')].uJr
- wG xR^[oƜchg`>b$*~ :Eb~,m,-ݖ,Y¬*6X[ݱF=3뭷Y~dó ti zf6~`{v.Ng#{}}jc1X6fm;'_9 r:8q:˜O:ϸ8uJqnv=MmR 4
-n3ܣkGݯz=[==<=G</z^^j^ ޡZQB0FX'+t<u-{__ߘ-G,}/Hh 8mW2p[AiAN#8$X?AKHI{!7<qWy(!46-aaaW @@`lYĎH,$((Yh7ъb<b*b<~L&Y&9%uMssNpJP%MI JlN<DHJIڐtCj'KwKgC%Nd |ꙪO=%mLuvx:HoL!ȨC&13#s$/Y=OsbsrnsO1v=ˏϟ\h٢#¼oZ<]TUt}`IÒsKV-Y,+>TB(/S,]6*-W:#7*e^YDY}UjAyT`#D="b{ų+ʯ:!kJ4Gmt}uC%K7YVfFY .=b?SƕƩȺy چ k5%4m7lqlioZlG+Zz͹mzy]?uuw|"űNwW&e֥ﺱ*|j5kyݭǯg^ykEklD_p߶7Dmo꿻1ml{Mś nLl<9O
-zpg_XQKFAǿ=ȼ:ɹ8ʷ6˶5̵5͵6ζ7ϸ9к<Ѿ?DINU\dlvۀ܊ݖޢ)߯6DScs 2F[p(@Xr4Pm8Ww)Km
-H
-}}}tttlll^^^PPPCCC222((( 
-H1
-bbb[[[III444///+++###
-
-
-
-HA
-tttlllPPPJJJ222(((  endstream endobj 737 0 obj [/Indexed 735 0 R 121 823 0 R] endobj 813 0 obj <</BitsPerComponent 8/ColorSpace/DeviceGray/DecodeParms<</BitsPerComponent 4/Colors 1/Columns 316>>/Filter/FlateDecode/Height 345/Intent/RelativeColorimetric/Length 604/Name/X/Subtype/Image/Type/XObject/Width 316>>stream
-HA
-}}}{{{yyywwwvvvtttqqqpppnnnlllkkkhhhgggeeebbb___^^^\\\ZZZYYYWWWVVVTTTRRRQQQOOONNNLLLJJJHHHFFFEEECCCBBB@@@???>>><<<:::888777555444333222111///...---,,,+++)))((('''&&&%%%$$$###"""!!! 
-
-
- 
-H̡
-rrrkkkWWWPPP???444///+++&&&""" 
-H1
-|||tttMMM@@@***!!! endstream endobj 810 0 obj <</BitsPerComponent 8/ColorSpace/DeviceGray/DecodeParms<</BitsPerComponent 4/Colors 1/Columns 316>>/Filter/FlateDecode/Height 345/Intent/RelativeColorimetric/Length 603/Name/X/Subtype/Image/Type/XObject/Width 316>>stream
-H
-H1
-kZaVX+
-kZa
-~~~wwwpppiiibbb\\\VVVQQQKKKFFF@@@<<<666222---)))%%%!!!
-
-
-
-HnFE/ b-Q Ϋ
-Hvv0< @ Ivot".V[
-c$
-Q _?c'I>jޟ?6S<?/EDƟLәL:J&T |,{>mT&ˋ\_sGe|TB^EHT\_zZ)T $
-К
-`<<Q`r|
-Tkcs:M:F\)
-'*hf9ﻎ5[RN  WZsa; +@
-p$FotA[-S
-W\7@:_mgkw<9)_'~=w%P&@c'<rRz)v
-@[0_
-Q噤8Eᨩ*0{d@B$6ǻy=#:*'dĹyLe
-4{4tCoȟOi
-
-^ʘ
-GL N$_Y}5
-rR)Z;(s^Ԕɰ Nƣa4
-O?o,o}] 0܃q׶uJ
-&|՟̌߀/oo/O\gihP
-,
-R5`9||~<ǘInTY6@HK@IR.`/ vmiLO N(/@ =<==7@TCa?ř_Y8h׊PT?G0L|b;]ms8Q0'>$
-<I'tP˪zE
- Y
- k! (rV4M(Xb@끅 4( _Bx%hbfTk*^D_Pub6@4%IE~_[UXb8 O!{
-l
-?-2Y>}`򉼦owzvqz '|o~  
-o S\:$I($eR
-k5;V#z:ڭ&å|}{A{fXt2mNpa6X$;ՙ{>
-{O39O2}+TbB}]k^p<<b9n%:Na#vZgR>/t0u;;wf9slۦm[Te_$d
-@}g<E+p
-`LWg0N I>
-$h
-'oiz26t*^X4B_/.a
-_`DgӢςHX6x|}]
-
-q
-/GS0 gs
-513 0 0 502 6522.5 7180.5 cm
-/Im0 Do
-Q
- endstream endobj 832 0 obj <</CS 735 0 R/I false/K false/S/Transparency/Type/Group>> endobj 833 0 obj <</BitsPerComponent 8/ColorSpace/DeviceGray/DecodeParms<</BitsPerComponent 4/Colors 1/Columns 513>>/Filter/FlateDecode/Height 502/Intent/RelativeColorimetric/Length 8911/Name/X/Subtype/Image/Type/XObject/Width 513>>stream
-Hvv0< @ Ivot".V[
-c$
-Q _?c'I>jޟ?6S<?/EDƟLәL:J&T |,{>mT&ˋ\_sGe|TB^EHT\_zZ)T $
-К
-`<<Q`r|
-Tkcs:M:F\)
-'*hf9ﻎ5[RN  WZsa; +@
-p$FotA[-S
-W\7@:_mgkw<9)_'~=w%P&@c'<rRz)v
-@[0_
-Q噤8Eᨩ*0{d@B$6ǻy=#:*'dĹyLe
-4{4tCoȟOi
-
-^ʘ
-GL N$_Y}5
-rR)Z;(s^Ԕɰ Nƣa4
-O?o,o}] 0܃q׶uJ
-&|՟̌߀/oo/O\gihP
-,
-R5`9||~<ǘInTY6@HK@IR.`/ vmiLO N(/@ =<==7@TCa?ř_Y8h׊PT?G0L|b;]ms8Q0'>$
-<I'tP˪zE
- Y
- k! (rV4M(Xb@끅 4( _Bx%hbfTk*^D_Pub6@4%IE~_[UXb8 O!{
-l
-?-2Y>}`򉼦owzvqz '|o~  
-o S\:$I($eR
-k5;V#z:ڭ&å|}{A{fXt2mNpa6X$;ՙ{>
-{O39O2}+TbB}]k^p<<b9n%:Na#vZgR>/t0u;;wf9slۦm[Te_$d
-@}g<E+p
-`LWg0N I>
-$h
-'oiz26t*^X4B_/.a
-_`DgӢςHX6x|}]
-HAnVDA䖚OfTĖ oo
-
-MH'Bz .5.oŮoy/tO~[~F=}o|u3& j]p[]ï҈7` x 7̶a#w_}T=rqg>!pU=iQEA-Q}L&t&t˚>Sd$kYugIV]YUaeuUUuEJ:ªα4SZimV]ڬ!k'Y+Pթ^1Utϯ UŦzUYRd$k'U+INvҵd$k'];ZJNvd$k)Y;INvUuǪʺ Y+ZINVeu ǚʺMuwZINVt$k%k'];IRvҵd$kSYu\UYӵNfu8Y+];INVvd-%k'];IRvҵtk)]KZJNvtk'Y+];IJvҵdk']+INvҵtk'];INVz6{tlV]tV]w|V]7r 8Umʪ.eu꺇Yu݃gu vҵtt8[еtk'];INvҵtk'];INvd$k)Y;IRvҳd-%k+Y[JU
-HviEV$9TE3Bm?̜U!px<=dx l{B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!(|8|4*?3yts"V\!nt~xPN? Jťpqg6O˫kq}}uya%$w^;.r9aʥz$K3hu5W׽RR%egёBK`0=nK_k<;%pk)jz bp'b/d^Y >81k.*Wǒt:@Z)ztA! <(|خ.?OgB.u)b/NG|(A,
-"}o~%'Èk(Η*F\$~NW*[7t&H!yI=S/vzdlju٢JkVbT*҉H+wQUE/U̙ao0)UNY-gaCZ#1Z,fZ5t\U}G+EJ_1}dhtz^iR bVh2jVըV/S˨ (h]Dϥ:44]{Ѱ׮0B SB٨5Z^mլ8;.a2Nsʧ%aPM^v6YYX'ɰ[/g`5KC1j֛p< nf=j<%q\Z>S|vT5g|65+8E`4-Tw}8dzg!@=?U9&A G衉D*\«J`X'|#S8 FrZikk= {Cva|')\.+ET5,ֺ#[L±T\mvzllnWixn5&[{ ղ*RT8 Z>dR|fsRBP.楈SERxZ/gk؏‰lĕ<̗vDM;Jꋋ7|Jzy ?
-#*P[(:hh6jID^O揤KdF mSMJ ^v\MDnܪdehB5e-h<ΈbDhJ]F8=hOW:lD8I\K6.֛aw[&'g*y!.sWn$ 5UDbbVZހѶd2qze+l٬d$Ry3b_T`F1J"aՖ\ݙxDH6֥BJ*VZt:]`KWY,l<C`,k^k4 F$ty+a}~y}}}~a: \fRIHX:dox"B*j;5
-ehu{pda],Wrmnת ~lIM-j! #x!Z^^?V^mJe3T2L=nam'ۉ?
-~]5D/Wi9_V?U^l#~7l*kKsXVETJ~jifVc{uM(}<Y/C۬=LNdmVBdQrV֒˯lUTeb\Kb[*@Q#BǶ(詓*3k aUb:굪 &ǣ&ɨi"{RltQ^
-2_3~Cj90YU~ױoVe8HcDG"lj#͢z
-U07~1Fr'(
-ىa ; aի\*8mv
-6/waVˌ<`jOX,Z>l1r$"AvN
-JR-V*^lҷTw'jkI9{YG泩X~cû}X*WV,P9 1daZy
-8,ޡmݡ[GTT!}vFF4Ɍ'32WIBmԪ$ ֫+(5ĥ@ ۠<%Ѕ +2tfK'/NSXCNZT!E,#OQzB0g- TmT5N%Ѱ^#K堒%4ŢX<A
-S 0ue31`ŜkըӱF {
-XL2Kk7" Q%֥ȥVP^Vc< AYE.Z #H8
-P$Z,RZ3znZ0yCé猅%aݨ2ŀ=qTŒTw;&VQ+ul4z (+e^TDju_[/-{Wpy>^ʖ\
-W&G:z}M&\dn h@[᪸Z)[SY-R9ѧ*qF G+6يZe`PsFڥfR^8.NYC!)ҀUMA%3ڴr=L]
-z8sRk$@jz
-ƹ"QH+حHץpUT.mifi׮z}}@ʪ$PĎ%l' W)an@dJ.-񀘹|: \v)^s2.
-h; UAݬf+5{IZ^^eOT2Մjva{|Ņ\/"LTk0r(0avho&UzL G64)RpȞS7#%OsS ^{Zy0x*tp`(bWԱo,Ei$XӹD C1ݭ6Z\5MzWe/ϳDm\_qfAQWa/,s~0EC`#=nJKU^)i@ ҩ]|ABFU<xQB*2ZT.$V]ݻdUIl*4Ɠ Z&Q`t6cPb|&*j~'z|GU%+]a0l"NBNa
-jcKZ504
-T^]LS5 x r,Ɓc}rUɪZ,!6x[.3q]A%R2U}=3=9$sьѠOXMnZ5]\WXcнmpvlT oQդ>'j/N{LڃeJVAcK߁\>aWɮDs9T_/TA`;C"-R-M\*9S %U*k?M^mV˶ .Knn'sL:KWkj'0H%Xz#jsxx:_Utrb:pd"έJXQMM9+ D~ڠh€:wZJ!э[
-_%~|W<LĚ̕mP%z[ Hud`vZj1T_ogG+uN倵q;V~eD4RU H<3}VKfg8]6v%l<wo[7:k6 .eo*^Q^
-8tZy%Zk4Hk/V<vkۘOvV5MT$^_ 3hKۃ1ǯoƆ
-VKY5O[Ot߮ǭcFVEEV"2d|BRpSout6ە kFfU(JĖJ*M,xA#k%tNFҴ׻z6*Q!E L&u8`D!Bm½x:[,͕Nts64ʪ,9<DV RI8ɰT}|4Lv7~`;Z8&Kg,C$ׯ'u</ 4kYI]׋f3id! Kz 7D
-V&ղ,jM4pƤ)P4J&T:C3l.c?kPg0
-+ܭyܭܰlǶWsXx
-ZU]a&p2"x~#'d:B_k*
-0A( @^n#RfA-h \Эu=ϗy%+c_/X NR /^{{z^ֵY%fMo;>2r9f|^uЮH+_}՗1TxUHq\Gzf0qH>+_wJZg4[X#rkVԂwu)dٟp|{1j/ ltbdΉj=ZጭB{MN]W,Z 'ԍ4E|Aw'=^_^ .ƽF(rwd5RfiDDؚ` w+
-պnk1*3Th 2)frp>_P+co׶VKZ v2LN%YVdPpfzEZmvMrDkЭ墦+iV5ZO Nʘz-Њ5%Z kBjzn[F^o:ttCk" ޙ`'/PB\ټU[h<~FӅl~ZL*Np[S"$f 4b>L&Srvj%pPz;z٬]{e(l?pV!,UPMVomzo
-ap<Bztخms>aB`KgwzlqqdЮE5\ ~C`EoWXکO[`X3Na2栵QV%%Z
-,Y^*UÙi:]]2Q]/ӉXh %I,kplqVNh !X4^ &a,ɨm7j"!8*"~`asb\Gt2;zU/)<k}"ZDT%\oV+
-V\6>!iXBĶ:n'0lDkVA+xEDT5&`[Mae"ZÃUd5R*WkZEG~XЀId*ar岯AzDkH+HM$T*Me,"t+ރcODkkEAMS $+ŢRa
-p7d
-tfe
-Cqךq\eˀX!/ycq%Z
-G+E3HV4E0iMi
-UQdnX+kx`N EYGҷ_xZS{\ժeM%Z3J|_YNTJj5UeQTjh TURzvbE8q_sIq, Q]UxF rH jY\ w7D|' ﮠS= R13-2P1Fh,N3n^ [-!XcFD2LRk~+%P`8(6ЩT*L| JMv/{a3^^.dSWVԩ|X*˕Z~&] ,g۬sןd~!"ЩJh4v?b˭t]S,7Z)ND^]1P‘X^%ix2_{E;v5z9Ah" 1MdX ˶-CSn26k<&1CPt6gYnI t:9QE5B'lS9\7~<1ک_$bgjv{Q a=_ΞcDcZ1 _zdqT-=_|_7+_oӟΜdXm6iܳWV3b8Fb=|٣&ZѺzz]/K[ Y_S9T|E`z߮yدĮx /:фоAX9GYXL]J~{ qV~|||m3V80waCag TwΗnqK<;!F]qӬx2xSBPPw] ﯠZFcd:[(_i&hW+os]P1GcD*Jfwpa_`0tԩv%vAG8勥Jg^9AܰtYJ슃5/+zZrS x]@]"]*VjVŘ[oEU7y.`Ռ6]qp\m{ј̹Fhئ4*4+z5+՚L Y7dةD5)T]U6*np̣rJ|]]^dXk[Z;7* 9=hUD슅\!!3_;@* Gz)G^vA˕]m]2, `~h o.zzf+Vױy/!vF_S٣N z}!a=a铉~:vaW
-n{~\osrH 㤗Kfp؆\?>׳K<;z%1돟ȰB \蜯'͜PMKA1Npl&
-9׫gGwQOOjk? ׻2R*Wr3ffyI`]ZφJP$qӃk*_nj_xJYR8*9TTŃy.1-GL^D^~s|%Ⱥ鸮cjfNW!ox*[6{tUݴmSWd*zR/?~&92Jaȳt/\? WX2+!|:U^.ވ;IQUy~b++fz5vԄ]m"ؕ7 vE|DYQ= | \]J3OXHaQVUEڭY+ W0<2:۽>0
-b=ʕ=C/aH (oDPmdzVTuòmda9*a bڵTRV:ܓZ9$a p< Nj.ںstkÄ+Vzp֡fj8]/K9;WpB 7z4K^7Zj:lzS//h$sfYleW@_oS
-qܳgҤ WR^\%t\읬C1\͓zR{գi;mUa\+B\#z'iAV3?rH@Ѣs9$HsmY51 Pvf5՚{6ҒUf9yUOr^Nr:Kyz3k<[|>DԊ*fNx:n=7Z!MW%9HBt U:Ui*FROt\a{JrnTFR_n"3Tmp|z~~z;Gk'/>r ˏorotU*qpo</^^^_U&誖Ϭh"ct+tUNֈRO÷y;rnY2k"/7|ݺn]`/aYӹbֺ>xMΫDWu80,R|}8?ۯCWE|<px2+Vw06ۣ~ihb:y>"t}|~~~ZٰSͧAGDW9X2+DF d:_k59G2kVo4[no02zw8Za2z1cMtUx*[l۝֗av۬f~Ka&u؟WHkT7۝Nj>jZ (5lRƭk,pG9}dLgb1zj!۟W*>X*'⻪ 3OD|65tYɧb!>]O*Xc ;Btr.BDXkixbf3Ӝ)r\Ȯz)DWE]DT SrZVZr^k4+7ylok{
-ZiFr;ÇnO]UsWZ}cdYvotUCk=0t: +y>*ՒUUkx-&y'"jZRy1m6z0֪2quٵ?6kyo֫b3s2{z9>]5_mFӹ|.dbx4vR$!MWU|v45}<5gё>z=MӺVV.dr6)*ޯzČ:fhj\̉V*ޯl*FR.B!fRX8Ǖ/Id
-zIWJQ3-Rd"U5.םSb۷V)iY3
-H8 %쾣:DWW|`|\VŬ
-KV8]x2+/j.GáQ=nɪp
-d:uHH[D#bnIy&
-v.FvH4ć5hgub~&[@0o;*Nta}~~/Wҗp ~II*v{Dۓ_ +fqG֯M
-
-q
-/GS0 gs
-472 0 0 526 6485.5 7240.5 cm
-/Im0 Do
-Q
- endstream endobj 838 0 obj <</CS 735 0 R/I false/K false/S/Transparency/Type/Group>> endobj 839 0 obj <</BitsPerComponent 8/ColorSpace/DeviceGray/DecodeParms<</BitsPerComponent 4/Colors 1/Columns 472>>/Filter/FlateDecode/Height 526/Intent/RelativeColorimetric/Length 11417/Name/X/Subtype/Image/Type/XObject/Width 472>>stream
-HviEV$9TE3Bm?̜U!px<=dx l{B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!(|8|4*?3yts"V\!nt~xPN? Jťpqg6O˫kq}}uya%$w^;.r9aʥz$K3hu5W׽RR%egёBK`0=nK_k<;%pk)jz bp'b/d^Y >81k.*Wǒt:@Z)ztA! <(|خ.?OgB.u)b/NG|(A,
-"}o~%'Èk(Η*F\$~NW*[7t&H!yI=S/vzdlju٢JkVbT*҉H+wQUE/U̙ao0)UNY-gaCZ#1Z,fZ5t\U}G+EJ_1}dhtz^iR bVh2jVըV/S˨ (h]Dϥ:44]{Ѱ׮0B SB٨5Z^mլ8;.a2Nsʧ%aPM^v6YYX'ɰ[/g`5KC1j֛p< nf=j<%q\Z>S|vT5g|65+8E`4-Tw}8dzg!@=?U9&A G衉D*\«J`X'|#S8 FrZikk= {Cva|')\.+ET5,ֺ#[L±T\mvzllnWixn5&[{ ղ*RT8 Z>dR|fsRBP.楈SERxZ/gk؏‰lĕ<̗vDM;Jꋋ7|Jzy ?
-#*P[(:hh6jID^O揤KdF mSMJ ^v\MDnܪdehB5e-h<ΈbDhJ]F8=hOW:lD8I\K6.֛aw[&'g*y!.sWn$ 5UDbbVZހѶd2qze+l٬d$Ry3b_T`F1J"aՖ\ݙxDH6֥BJ*VZt:]`KWY,l<C`,k^k4 F$ty+a}~y}}}~a: \fRIHX:dox"B*j;5
-ehu{pda],Wrmnת ~lIM-j! #x!Z^^?V^mJe3T2L=nam'ۉ?
-~]5D/Wi9_V?U^l#~7l*kKsXVETJ~jifVc{uM(}<Y/C۬=LNdmVBdQrV֒˯lUTeb\Kb[*@Q#BǶ(詓*3k aUb:굪 &ǣ&ɨi"{RltQ^
-2_3~Cj90YU~ױoVe8HcDG"lj#͢z
-U07~1Fr'(
-ىa ; aի\*8mv
-6/waVˌ<`jOX,Z>l1r$"AvN
-JR-V*^lҷTw'jkI9{YG泩X~cû}X*WV,P9 1daZy
-8,ޡmݡ[GTT!}vFF4Ɍ'32WIBmԪ$ ֫+(5ĥ@ ۠<%Ѕ +2tfK'/NSXCNZT!E,#OQzB0g- TmT5N%Ѱ^#K堒%4ŢX<A
-S 0ue31`ŜkըӱF {
-XL2Kk7" Q%֥ȥVP^Vc< AYE.Z #H8
-P$Z,RZ3znZ0yCé猅%aݨ2ŀ=qTŒTw;&VQ+ul4z (+e^TDju_[/-{Wpy>^ʖ\
-W&G:z}M&\dn h@[᪸Z)[SY-R9ѧ*qF G+6يZe`PsFڥfR^8.NYC!)ҀUMA%3ڴr=L]
-z8sRk$@jz
-ƹ"QH+حHץpUT.mifi׮z}}@ʪ$PĎ%l' W)an@dJ.-񀘹|: \v)^s2.
-h; UAݬf+5{IZ^^eOT2Մjva{|Ņ\/"LTk0r(0avho&UzL G64)RpȞS7#%OsS ^{Zy0x*tp`(bWԱo,Ei$XӹD C1ݭ6Z\5MzWe/ϳDm\_qfAQWa/,s~0EC`#=nJKU^)i@ ҩ]|ABFU<xQB*2ZT.$V]ݻdUIl*4Ɠ Z&Q`t6cPb|&*j~'z|GU%+]a0l"NBNa
-jcKZ504
-T^]LS5 x r,Ɓc}rUɪZ,!6x[.3q]A%R2U}=3=9$sьѠOXMnZ5]\WXcнmpvlT oQդ>'j/N{LڃeJVAcK߁\>aWɮDs9T_/TA`;C"-R-M\*9S %U*k?M^mV˶ .Knn'sL:KWkj'0H%Xz#jsxx:_Utrb:pd"έJXQMM9+ D~ڠh€:wZJ!э[
-_%~|W<LĚ̕mP%z[ Hud`vZj1T_ogG+uN倵q;V~eD4RU H<3}VKfg8]6v%l<wo[7:k6 .eo*^Q^
-8tZy%Zk4Hk/V<vkۘOvV5MT$^_ 3hKۃ1ǯoƆ
-VKY5O[Ot߮ǭcFVEEV"2d|BRpSout6ە kFfU(JĖJ*M,xA#k%tNFҴ׻z6*Q!E L&u8`D!Bm½x:[,͕Nts64ʪ,9<DV RI8ɰT}|4Lv7~`;Z8&Kg,C$ׯ'u</ 4kYI]׋f3id! Kz 7D
-V&ղ,jM4pƤ)P4J&T:C3l.c?kPg0
-+ܭyܭܰlǶWsXx
-ZU]a&p2"x~#'d:B_k*
-0A( @^n#RfA-h \Эu=ϗy%+c_/X NR /^{{z^ֵY%fMo;>2r9f|^uЮH+_}՗1TxUHq\Gzf0qH>+_wJZg4[X#rkVԂwu)dٟp|{1j/ ltbdΉj=ZጭB{MN]W,Z 'ԍ4E|Aw'=^_^ .ƽF(rwd5RfiDDؚ` w+
-պnk1*3Th 2)frp>_P+co׶VKZ v2LN%YVdPpfzEZmvMrDkЭ墦+iV5ZO Nʘz-Њ5%Z kBjzn[F^o:ttCk" ޙ`'/PB\ټU[h<~FӅl~ZL*Np[S"$f 4b>L&Srvj%pPz;z٬]{e(l?pV!,UPMVomzo
-ap<Bztخms>aB`KgwzlqqdЮE5\ ~C`EoWXکO[`X3Na2栵QV%%Z
-,Y^*UÙi:]]2Q]/ӉXh %I,kplqVNh !X4^ &a,ɨm7j"!8*"~`asb\Gt2;zU/)<k}"ZDT%\oV+
-V\6>!iXBĶ:n'0lDkVA+xEDT5&`[Mae"ZÃUd5R*WkZEG~XЀId*ar岯AzDkH+HM$T*Me,"t+ރcODkkEAMS $+ŢRa
-p7d
-tfe
-Cqךq\eˀX!/ycq%Z
-G+E3HV4E0iMi
-UQdnX+kx`N EYGҷ_xZS{\ժeM%Z3J|_YNTJj5UeQTjh TURzvbE8q_sIq, Q]UxF rH jY\ w7D|' ﮠS= R13-2P1Fh,N3n^ [-!XcFD2LRk~+%P`8(6ЩT*L| JMv/{a3^^.dSWVԩ|X*˕Z~&] ,g۬sןd~!"ЩJh4v?b˭t]S,7Z)ND^]1P‘X^%ix2_{E;v5z9Ah" 1MdX ˶-CSn26k<&1CPt6gYnI t:9QE5B'lS9\7~<1ک_$bgjv{Q a=_ΞcDcZ1 _zdqT-=_|_7+_oӟΜdXm6iܳWV3b8Fb=|٣&ZѺzz]/K[ Y_S9T|E`z߮yدĮx /:фоAX9GYXL]J~{ qV~|||m3V80waCag TwΗnqK<;!F]qӬx2xSBPPw] ﯠZFcd:[(_i&hW+os]P1GcD*Jfwpa_`0tԩv%vAG8勥Jg^9AܰtYJ슃5/+zZrS x]@]"]*VjVŘ[oEU7y.`Ռ6]qp\m{ј̹Fhئ4*4+z5+՚L Y7dةD5)T]U6*np̣rJ|]]^dXk[Z;7* 9=hUD슅\!!3_;@* Gz)G^vA˕]m]2, `~h o.zzf+Vױy/!vF_S٣N z}!a=a铉~:vaW
-n{~\osrH 㤗Kfp؆\?>׳K<;z%1돟ȰB \蜯'͜PMKA1Npl&
-9׫gGwQOOjk? ׻2R*Wr3ffyI`]ZφJP$qӃk*_nj_xJYR8*9TTŃy.1-GL^D^~s|%Ⱥ鸮cjfNW!ox*[6{tUݴmSWd*zR/?~&92Jaȳt/\? WX2+!|:U^.ވ;IQUy~b++fz5vԄ]m"ؕ7 vE|DYQ= | \]J3OXHaQVUEڭY+ W0<2:۽>0
-b=ʕ=C/aH (oDPmdzVTuòmda9*a bڵTRV:ܓZ9$a p< Nj.ںstkÄ+Vzp֡fj8]/K9;WpB 7z4K^7Zj:lzS//h$sfYleW@_oS
-qܳgҤ WR^\%t\읬C1\͓zR{գi;mUa\+B\#z'iAV3?rH@Ѣs9$HsmY51 Pvf5՚{6ҒUf9yUOr^Nr:Kyz3k<[|>DԊ*fNx:n=7Z!MW%9HBt U:Ui*FROt\a{JrnTFR_n"3Tmp|z~~z;Gk'/>r ˏorotU*qpo</^^^_U&誖Ϭh"ct+tUNֈRO÷y;rnY2k"/7|ݺn]`/aYӹbֺ>xMΫDWu80,R|}8?ۯCWE|<px2+Vw06ۣ~ihb:y>"t}|~~~ZٰSͧAGDW9X2+DF d:_k59G2kVo4[no02zw8Za2z1cMtUx*[l۝֗av۬f~Ka&u؟WHkT7۝Nj>jZ (5lRƭk,pG9}dLgb1zj!۟W*>X*'⻪ 3OD|65tYɧb!>]O*Xc ;Btr.BDXkixbf3Ӝ)r\Ȯz)DWE]DT SrZVZr^k4+7ylok{
-ZiFr;ÇnO]UsWZ}cdYvotUCk=0t: +y>*ՒUUkx-&y'"jZRy1m6z0֪2quٵ?6kyo֫b3s2{z9>]5_mFӹ|.dbx4vR$!MWU|v45}<5gё>z=MӺVV.dr6)*ޯzČ:fhj\̉V*ޯl*FR.B!fRX8Ǖ/Id
-zIWJQ3-Rd"U5.םSb۷V)iY3
-H8 %쾣:DWW|`|\VŬ
-KV8]x2+/j.GáQ=nɪp
-d:uHH[D#bnIy&
-v.FvH4ć5hgub~&[@0o;*Nta}~~/Wҗp ~II*v{Dۓ_ +fqG֯M
-
-HN@ i@RrM;'yY{4e1c<O>flc]DZT+A6L65)'|5&`HԂi—#j
- _=!dMJ<i橫vJ4s\4v>g
- esӸT>U4g8 mf_,'p3Lk̚uԆͬN)>nu< AOK XKvO=ѣKvyCO+(4QU=EyzBO^+= e)īVS쉖\3<kTO,=S'M=MĻ&{JdOW穧({bÞ6G)STZX7OT\O0(*c (jZZ45QIph']ǀ.gݥ-zPh8G3(`vgCkHڻd|ex8!<c1c1c̛!
-HWcCz
-()RT `&ƶ4ƨIxo'IZ>3{^׽u{ש tU'IM)4_QKUX
-JUE1@t:J!#T-7OR0eP &fsq\f1TJm@4߮J&BH$HRL&J%"âSɤ'pp6 q
-aP7
-0(,q~Pک 6O$Sj.bZm6ۭ]fV)r4r[狤*L 7U͗(6@ yLE ިp;
-h2pqiUDGbx"L'Hm3(B!3ܫ'VL鰚 *M'_&Wljv2!ƇSD.ShnRK,j{k˕ 5\
-#Rn8-8UPݯ4TRtPrTvrzX ZZ\(&RfP8trべvRTc{h8su< k&կAET+Qp239;hcsk{gwwwg{ɣɱS#1\|~"hlBoF#؀iHx8Qd hy_h2'L6vONN?\_ˍ{m
-J8RiXN9GG'fWo?uӗo߾|zwhR1F c19|1$ V%Xt
-n?HmvшעraCpnb6"Q\5t@Ǝk;N4Ha3Sh/_>szXL2( =6-Brf 8AˤW|v=fJ(M <rNLBڀ A/
-դS(qe*a4T2I'9A&,n8(6_6WӉթysЦQr.^oRSJtFe l8箁19huB!K`8uvb4A6tX=>/b) %eC'Qm=tnz~u۷7Wʅhlb.+mhu'Da8:* U3H027:ʉpMf\."Sogu1 .YO۝rL5ٺ}}Tyu듃T& F 6l*@79K$!5Df0OxwKN8:ٽLT*M3Ɉ: +VvX{Dj|"7ͤhMTjZ=%J s_$.<|{ųt<qTLs`Dcdn<]:]o3AWO"39==9Dx~S~LmZ]]]^(<D4WYX-2Ã!äҮZƟ {D1-@b|f{Of2^SjY!aoN$" `RIx``k8vԅlSt6*wbK)lЙ入奅 9.TxIw{AUxxnV?2/>^+G>'4BZVA&XA=
-%sb>Vdw #oﺠƑXc&s77dЮkOa`"j6QX:_TJ$ 3o^s2:ʦW
-Ɔ=O*vـy*f b9Fw7uʠu< 1$ㄠ)(@v>S Kmu$qXL% 4](WjR65̼p9<^p!:X`b#)7ڏ%2(DN\6C;al'
-Hٵ}ѥ-̓yR/%u/ή?9Ufxk%GI\Wc<3G 52;Z _u7Kg҉ۢe 'F]*) E3Im &
-״]Id<t]Tcxx[k߷jLҟl-N}b#D'Hfōx&6O xvR!JD @ierR): 1 ;5(Ntȩ&S]~h7+Ϭbdg&WP2% #9ɍD88U˅u<؍ ý]t< BgL8gBcpTJv?3!Blp2WfX TyDztmHd!btm1Yh `Ͼ`,!9!lKhV+ĽF9UĮ.'3JMʵc6v$(xGgҡǦ.YNd7w,׸orQqZ2>q<{Z n0}lxzy\wJЉz]N̗SPF.M`ٛJׯj>6A-MsG.r
->(B'K_̸Iu0Ƨ:. }0Fs+
-1^݄Gil̜]+R_/K0(lP.h؏eDd"FIJ%0NnŨ a#N}1L(;H:h~~ylSW6*`(x|=ÎWءS*EN<CsyhQGzR6!sHe0(ۀ<`p"ĄU/oZ3ݬ⍦!4[UL&z 4TNF(@IEp
-ٶ|s 4>u,Rh fIv&G&ycL՛^w)n+i8L
-^4},RdCR&fNy}>Mv+)0/d {<RU+vدč r0Љ}_xN%d ϟ*UWFb:Zw4_?>}xz1mk$ѹ[lmB] 9vE˟?ÚW dl_^^_v5g[r٬fL~@I.ڃv^.ȐqFroq
-uw|Z_аC-J"ݖ.;8c9ѽW;0fs^-aQ%8c7Rj?ӋAVr:1('_ivry9 2)Cq:qZRHdo3;pr\}]ZLGVtxX^- NZ& o Y@q{=Rb FѰj\ct! \nTP8dN"nK5t;$vhױt:l<j\op0NլW\Ƙr%rJ^UDNIjvr@j
-cHcBfH4c2{d4s TFp,F(#v">
-
-S‘bGR
- yV|8zr](lG9;
-î.Tq 't:J=E\o:/4 0
-q
-/GS0 gs
-296 0 0 91 6647.5 7516.5 cm
-/Im0 Do
-Q
- endstream endobj 844 0 obj <</CS 735 0 R/I false/K false/S/Transparency/Type/Group>> endobj 845 0 obj <</BitsPerComponent 8/ColorSpace/DeviceGray/DecodeParms<</BitsPerComponent 4/Colors 1/Columns 296>>/Filter/FlateDecode/Height 91/Intent/RelativeColorimetric/Length 6141/Name/X/Subtype/Image/Type/XObject/Width 296>>stream
-HWcCz
-()RT `&ƶ4ƨIxo'IZ>3{^׽u{ש tU'IM)4_QKUX
-JUE1@t:J!#T-7OR0eP &fsq\f1TJm@4߮J&BH$HRL&J%"âSɤ'pp6 q
-aP7
-0(,q~Pک 6O$Sj.bZm6ۭ]fV)r4r[狤*L 7U͗(6@ yLE ިp;
-h2pqiUDGbx"L'Hm3(B!3ܫ'VL鰚 *M'_&Wljv2!ƇSD.ShnRK,j{k˕ 5\
-#Rn8-8UPݯ4TRtPrTvrzX ZZ\(&RfP8trべvRTc{h8su< k&կAET+Qp239;hcsk{gwwwg{ɣɱS#1\|~"hlBoF#؀iHx8Qd hy_h2'L6vONN?\_ˍ{m
-J8RiXN9GG'fWo?uӗo߾|zwhR1F c19|1$ V%Xt
-n?HmvшעraCpnb6"Q\5t@Ǝk;N4Ha3Sh/_>szXL2( =6-Brf 8AˤW|v=fJ(M <rNLBڀ A/
-դS(qe*a4T2I'9A&,n8(6_6WӉթysЦQr.^oRSJtFe l8箁19huB!K`8uvb4A6tX=>/b) %eC'Qm=tnz~u۷7Wʅhlb.+mhu'Da8:* U3H027:ʉpMf\."Sogu1 .YO۝rL5ٺ}}Tyu듃T& F 6l*@79K$!5Df0OxwKN8:ٽLT*M3Ɉ: +VvX{Dj|"7ͤhMTjZ=%J s_$.<|{ųt<qTLs`Dcdn<]:]o3AWO"39==9Dx~S~LmZ]]]^(<D4WYX-2Ã!äҮZƟ {D1-@b|f{Of2^SjY!aoN$" `RIx``k8vԅlSt6*wbK)lЙ入奅 9.TxIw{AUxxnV?2/>^+G>'4BZVA&XA=
-%sb>Vdw #oﺠƑXc&s77dЮkOa`"j6QX:_TJ$ 3o^s2:ʦW
-Ɔ=O*vـy*f b9Fw7uʠu< 1$ㄠ)(@v>S Kmu$qXL% 4](WjR65̼p9<^p!:X`b#)7ڏ%2(DN\6C;al'
-Hٵ}ѥ-̓yR/%u/ή?9Ufxk%GI\Wc<3G 52;Z _u7Kg҉ۢe 'F]*) E3Im &
-״]Id<t]Tcxx[k߷jLҟl-N}b#D'Hfōx&6O xvR!JD @ierR): 1 ;5(Ntȩ&S]~h7+Ϭbdg&WP2% #9ɍD88U˅u<؍ ý]t< BgL8gBcpTJv?3!Blp2WfX TyDztmHd!btm1Yh `Ͼ`,!9!lKhV+ĽF9UĮ.'3JMʵc6v$(xGgҡǦ.YNd7w,׸orQqZ2>q<{Z n0}lxzy\wJЉz]N̗SPF.M`ٛJׯj>6A-MsG.r
->(B'K_̸Iu0Ƨ:. }0Fs+
-1^݄Gil̜]+R_/K0(lP.h؏eDd"FIJ%0NnŨ a#N}1L(;H:h~~ylSW6*`(x|=ÎWءS*EN<CsyhQGzR6!sHe0(ۀ<`p"ĄU/oZ3ݬ⍦!4[UL&z 4TNF(@IEp
-ٶ|s 4>u,Rh fIv&G&ycL՛^w)n+i8L
-^4},RdCR&fNy}>Mv+)0/d {<RU+vدč r0Љ}_xN%d ϟ*UWFb:Zw4_?>}xz1mk$ѹ[lmB] 9vE˟?ÚW dl_^^_v5g[r٬fL~@I.ڃv^.ȐqFroq
-uw|Z_аC-J"ݖ.;8c9ѽW;0fs^-aQ%8c7Rj?ӋAVr:1('_ivry9 2)Cq:qZRHdo3;pr\}]ZLGVtxX^- NZ& o Y@q{=Rb FѰj\ct! \nTP8dN"nK5t;$vhױt:l<j\op0NլW\Ƙr%rJ^UDNIjvr@j
-cHcBfH4c2{d4s TFp,F(#v">
-
-S‘bGR
- yV|8zr](lG9;
-î.Tq 't:J=E\o:/4 0
-H @MM}ZÄ
-f;q!!#ebH8R#eH9R#H9R#H9R#H9R#5Ƒp4Xr0Xruϯ\ yOM,#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#!H9R,#!!bb7so
-H{Lg=PxB)VZ"
-"iTj a+a5`R7 x"8  Cˈ8E$H!)'%/徯y>{lDZAheA&?c Z+0337701i{B1P{}X[<I ܘC'`kڊawc@V-ށH80?G=N#|Id ͕`0L ݕB!6 |Ґ,! v$
-t`s<=LOOÝIRHv%@B$S,׏/|f|?_Š@%FkhL7 Cvm" <o6DD,KBapPiX,2*:ƄEICŁ|.E#Y6b E G(MّÊ?älChFHab,N<z,%-=#ӄHOK9vTI\6B!Y0ֈ,oH%WҳO9V3YgNd(͢<la5b!ؒl^D&OJ+T|g4VVzRA^Nj\& d[8azq\uQion^^Z;U7VYZMUƅ^L06FbYۻ<VW\Up~i-߿oֵbu`
-%чRN_o
- A0 gǞ_!Mq3m隦k)2t4"fzЋ1E"8$*Ԃ"^Eu7^ftQ"&y~SiV 9O<೗o=o WΟ0 7w5G/8<lln3ᔌsJs3Rtp={|3q@hHzNrD.;Ksҏ#C64~Q_QC"I"%;)DEw^/H-%:KNoxmO'- E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QFdD~/"H"2[ԵHO[ko%.to&x21q >^8;d%k)kqu,,i]2O//̌wZꊅ^~"~`]T|oڇ<ˑ;͵Eif>X'GSK;{O-[}ޯ[z>yRTZ,ETBzfg3oWV=ff㎛MՅ'BD%CqIU7>}jfn~af^|tFcUxRىx4X1ۙݽCc/&gf_{jvfzjPow3cXF-3&<&ђWlua/'&=51ѡn5;,1D|AaQ 9kC#OƤ;q`׵jGNFjBTXWV"^޾Hj/w^qo_׉K}us],Ϸ[HmD!8%3kvtvuǤk]wo]x07bӇ(d&"Z5:>j+t64_qS.ם7o\mnpV٬)*q*ec0MW;.5zRSc0Ϟ~dRV_[:XmLreU5uRNL\(s-Ih]_V{#CO:jʹ)(txQXp&/Ǟi=#"mĽ!h#b5#f?y*ve:ieeX-)&cLV1"rF
-KF 6ϝb6nKYF^bNA 0`6y~Yƾ
-q
-/GS0 gs
-274 0 0 303 6622.1162109 7246.1401367 cm
-/Im0 Do
-Q
- endstream endobj 850 0 obj <</CS 735 0 R/I false/K false/S/Transparency/Type/Group>> endobj 851 0 obj <</BitsPerComponent 8/ColorSpace/DeviceGray/DecodeParms<</BitsPerComponent 4/Colors 1/Columns 274>>/Filter/FlateDecode/Height 303/Intent/RelativeColorimetric/Length 4305/Name/X/Subtype/Image/Type/XObject/Width 274>>stream
-H{Lg=PxB)VZ"
-"iTj a+a5`R7 x"8  Cˈ8E$H!)'%/徯y>{lDZAheA&?c Z+0337701i{B1P{}X[<I ܘC'`kڊawc@V-ށH80?G=N#|Id ͕`0L ݕB!6 |Ґ,! v$
-t`s<=LOOÝIRHv%@B$S,׏/|f|?_Š@%FkhL7 Cvm" <o6DD,KBapPiX,2*:ƄEICŁ|.E#Y6b E G(MّÊ?älChFHab,N<z,%-=#ӄHOK9vTI\6B!Y0ֈ,oH%WҳO9V3YgNd(͢<la5b!ؒl^D&OJ+T|g4VVzRA^Nj\& d[8azq\uQion^^Z;U7VYZMUƅ^L06FbYۻ<VW\Up~i-߿oֵbu`
-%чRN_o
- A0 gǞ_!Mq3m隦k)2t4"fzЋ1E"8$*Ԃ"^Eu7^ftQ"&y~SiV 9O<೗o=o WΟ0 7w5G/8<lln3ᔌsJs3Rtp={|3q@hHzNrD.;Ksҏ#C64~Q_QC"I"%;)DEw^/H-%:KNoxmO'- E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QFdD~/"H"2[ԵHO[ko%.to&x21q >^8;d%k)kqu,,i]2O//̌wZꊅ^~"~`]T|oڇ<ˑ;͵Eif>X'GSK;{O-[}ޯ[z>yRTZ,ETBzfg3oWV=ff㎛MՅ'BD%CqIU7>}jfn~af^|tFcUxRىx4X1ۙݽCc/&gf_{jvfzjPow3cXF-3&<&ђWlua/'&=51ѡn5;,1D|AaQ 9kC#OƤ;q`׵jGNFjBTXWV"^޾Hj/w^qo_׉K}us],Ϸ[HmD!8%3kvtvuǤk]wo]x07bӇ(d&"Z5:>j+t64_qS.ם7o\mnpV٬)*q*ec0MW;.5zRSc0Ϟ~dRV_[:XmLreU5uRNL\(s-Ih]_V{#CO:jʹ)(txQXp&/Ǟi=#"mĽ!h#b5#f?y*ve:ieeX-)&cLV1"rF
-KF 6ϝb6nKYF^bNA 0`6y~Yƾ
-Hױ 0CAfDa$ M@ :ߔ())-JAҢ()-JҢ(-JҢ(-JҢO--JK"ƒ-=Ϲ88MCkܗ8ǯ
-HkY
-A.W(l1cR@
-`
-hco5j
-EOqiڇjV?)?ch_u6PL'x")y\Y~OcuL!?&х=5prbޓO_} )@߾n|Z_}W~rtq@t.g?ogNm~~k5o
-=Bϻ,CX#R/di+kwz:yGwzvJ
-lw-vdZ=E3vfw8m\)ث C26`A6( LJu
-X ІZՑ`@$uZC . pL U*ZM RMҨb2\P(k`ĔC{KS A%hS
-E쫢ncKv >Ф6 0
-q
-/GS0 gs
-268 0 0 44 6625.1162109 7475.1401367 cm
-/Im0 Do
-Q
- endstream endobj 856 0 obj <</CS 735 0 R/I false/K false/S/Transparency/Type/Group>> endobj 857 0 obj <</BitsPerComponent 8/ColorSpace/DeviceGray/DecodeParms<</BitsPerComponent 4/Colors 1/Columns 268>>/Filter/FlateDecode/Height 44/Intent/RelativeColorimetric/Length 1219/Name/X/Subtype/Image/Type/XObject/Width 268>>stream
-HkY
-A.W(l1cR@
-`
-hco5j
-EOqiڇjV?)?ch_u6PL'x")y\Y~OcuL!?&х=5prbޓO_} )@߾n|Z_}W~rtq@t.g?ogNm~~k5o
-=Bϻ,CX#R/di+kwz:yGwzvJ
-lw-vdZ=E3vfw8m\)ث C26`A6( LJu
-X ІZՑ`@$uZC . pL U*ZM RMҨb2\P(k`ĔC{KS A%hS
-E쫢ncKv >Ф6 0
-H F
-H?'uV7$sL QKBT䆵%*rlk(3`|En}~~}5B)I7F}%Y^F}-iзF
-胯Z~:koO[.%SMG:~o.qWNA8 },3D9>p2!y ЗF}-i ^F}%YF })IWB}5[0G`_g ~oKRȔB6M%t*S:(!+
-Hy<{KeXNǾeɞٲg:gR2D#˄K!B"Iɒ%Fi;s}<u?x>d@}S Z\~vVFFfFV
-;KWVeʯ;Ò
-dK$AA m pq 
- Pk!!A~>^^n.$.ˆ&$["?O)h 0`@daQ1 I,/++#-& @!`$ppmTT@b_PXDL\v+)kZ45  u5Ue
-r
-4
-Lu'STRQ'h[XYw8t?]]99pgkmeanjblEPWQRKD
-!<s..>1BJjZzFfVvvv
-~fef\HJ;}:2"D()$qC]Mu ᄉ,fRp I)hhY"/`RɈظԴ+WKJ+*Q(/+-Z| ?7'+#-59)!.6:*d()8쒖d_ ޏZI+ ,WR ;'7O߀`3s/].ZRV~f}C㭦۔n56߬V^Vr쌋ɉc#Ï}<\a$5%yY
-SǞ9v,$Dlhk(+YRF dSXθPT!Y;D<I
-sN!Q1\+,.khjik ~:ltl Jp=599||l KoOwg{[KS}] d$Łȱo7'{k3#]X,NTX0:@a-[JP'Q:H<q*:.bVuM-w:`hxdt ϼ?PWfg_΀  r܌į#N}+H ȦZńBBZNI] "E'7ģAp~1_XxwH ~[\|͛`f^LON`[o7U"9c"HANVZjx)1!4KFXefWT20w/OF&d_)Fc}b98DÇ?B ݀c4fTf_|$tuk%W2SbH>nv{0~nV+-8yĤ4t-|I@uv[Gw'C179, 0?C+m[Csd2?$Ϟ=jomRVjBld1P[m7 ۃbX K˫hZ;x"UuwL l=ʖRh M~x5?;3=9>
-"{mn*/s*4>=zJrp`rmXU\|B2
-چ{C#Ƨ u-]" 8 VVV,lxL(?Bܙ/]ؘhK Xg_kEP1?@<y&BF~QY}<8261=3 o OrƅB&A"d{rnZRlÎv{Ud$NQ恆B,,xIs_ܗ?hnsgJ)eI
-aR
-PMԡ\#ʈk%)#eKٳɚc> s络Tw9O<~@?8e C 
-l ٴ丘ۡ.gľ56c<|}5GtK
-Xw,t-)nqIJ 4L`B},8dzdldpWWLM޽y1'tKjpMK00urIJF^qEu=Jd's"$I $0'=9~D#X_D<x="$,xx I gw(jBZVA٫֎~H;
-!2# Ã}oj*J^d<pˇ*a>^T)oyxWIJG,<|&r^V74wP ?13@|Vz]UYAvZ5*,
-O_+n,Vqn:~m׭Y)H cp @yoTV۽99ƢݏbQAB^[YGps<avHwVE\W\Ā%$%e!nX_$?+yUGoXX`=(@X2:FyDx_65ܣa-3|" )U ¢/ 1UAx<wB\Noi+`/GN)?,)Ymz&V\CPYY E1b,@P@Ɔ0Źć<Zއt
-9.sJ`lP 28{~H-DY0b6,<E,IuPGa)11P0Ե Z;^S ;=G0{ޮ+=M5%<h\qRX0`3sjgY5>dncX]{'GOg;Tx,ۃ ʜԷ<˅İ`0=q%8_^vg ѡ<Z>Qeo+R -_f<4)WiU -]}C<~h,]]:g P[Z" K VR28jx/$QJVQe]SG =_&Gk^g$Qo]vw8~Do6-mšjVڨ
-FLBƶ#p_p4 sػ] U%iO!:ʲb8<X-ek+(ů[&&CY@̧ _3۹Yn+26R2J۴ (~QCoI(7~Ejk|]GxVUv.Kɩ5:}7(2S^of}6/LF\jgqhMbB`T~aR6Na4 hwzx}6o.M}|78JUNjՊWʀOZYZ̢ER3>6o(xs3ISͭ%ʃ.V4<v98*.5!)v]u$;%6'W;:۔rZy0X&sEu0Q0KRΦ'wC[j@y˃Spcj!\24 LO!,o1F`p# xLO¸n,Hq~<-^8Иk6(i۝ (574JfcluISj5sc[֭ƺp0ИZ).w{񸥰ƦD<*/-.*)sCm5 kifę`Q5>#&)Y
-)RпxeR_Q~u%iq4؍ʎ}&6^ԧ%1K1`/l$TǍt+p
-ooTCcvD;Yiʉ 3;h~@4~L! yk{L.?3hawG CmY1n`{.4cLfvAq9FyHmj?#?+)5Z2sؘh=;:- &mh}`F eI[ .@StC G`tҡ_L> 4f-lQK ̷G&eݸG3&񪮢,/#1wK%A3OIc>3w7ӫvK }\HA\ݩ̠J}{|3*;z~K3T[^zbQ]6V!H>JpAqyu];c oWԽBf>Q8#[iŊ6ЀuJuNи WK6xOf=_V?u%dŚe 狀bHt`eh+8\N`F?])чݶlX$5 |{ߊV|C2n|^AVRġMC$h!L\x O:|jy^y'/qg[Hr1Zc rj:&.3>mh~;8Lf񮯳qvXi)K
-\G nKAiv5V mg&+o
-Ǵiа~&^Ջ:ʲK G1tb9e,>ie-
-x A v|
-#++L[Pk`>a_W n93 6.go=k&Էߪ yo4Pf6Y!ȿWSdU=m eɊΦ"3sH`Sykw{O}[ \(;9gR%)!n6&[nAIEMK`j w7v0:O{lY.;p[Y5]S{p|jf|[ȋDX-[ %CU8P4ظa5]!GȟݿA EcSyw1w<a i}^QfւyԄ~ YF\).oNA0uyPꅅpFCnGϐ:hP47-oZ 씆 a`J)@8@0t~'Tcb4B2 Լ$N0yXy15 ~iOvK>~$aaTh,
-4>WύZF ە P(0$rP9`4,i"9R9(Jˌl\EѠZx8px9AI8M 3VPhfPO7)!n6Fr#+RCkgH5@£_Qr`q,3Ì*p&v^iUS#7ѠZuh$
-Y
-
-vHRR 4. ![dD88Z~<󕗛ػJϿW7HD:hkxRle(!Jg0'&x%g?o!Aqƥ`wS9d\Rno@̅w^vh[:aik(r6gq~NrJ.b8zM\h 1^~zlfpqpV. EMCkCiW˞h}G0zp ֗N:mJ
-0*;|^)y I G7Nzn]*#Bbd/ "J/w=ߺ"sf2EdȔS&D ET
-4g*J
-X eCDGwf6znkӽ z>|k|QcRѷt O)G-|?c#hɽsx\Q}:#cc.+ px4p8?l(M <.<>թ" ~:<|KjHC*-UEmMEǧ<U!jﯗ" ZrI?s
-:`=UHe}!#}qve&6.g?H/F<T=Uhz~ gkÕB\ xow {^R~NUokMqo7])'x$ [JzNI卝Q
-Ӣю&#BW$m+]? NAN觾vqcow3ՒYDOdmH*[>ۏ񎛝pFEq> iCXFhSWӊ`7&?%=* y-S;7cmgЎ;ZU}c\:N.;X(y7I6.h9șZA1xp I$qL8E_6p &8(C8Pm0)A`(@![SM9z
-@gcyNrbj&ER! b`|JTTCRThJe
- >6Ry̜BjF[V*4ʂ'.{W)Uh
-ɶn>}U+1AhRZUu Jjڻ=] "hVSs Vq9*.MM.kTm&Twƌ2)BA!>nfZr47$Vb302%MsGXp $ر^{(+- 07,x] XFcWSEnRţuy& 27$F+D`pDz: @SPZzߩk_V¹APh28& ?d ,msPGaZԕV*J6Gl1V2SD,@[xZCo=|G_{mq&И½dwHa87 yվz{㬋59-2w .m㏨`go;DCV8S iFGq]mj,[ h̚@Gtz;M]QAP(T1LcFWLaǣ“*>Ai|hٛjQLl:v H i@gCYv|-l|+t͝<#S^mAHX4 vJz.{RP38
-iF@#};Bc15 ƅt?]WH| )+Wӊ[{Rq aR]cԵ/k 2- FfNAF[Q h|iicQ3q9[vHiХ1%$nlrFS@AX(:H@?S2 h4Ӏ \?SɫiEխat?]BߐNK,v{]gpt &CObg`dʋ-݃#A!h
-q7Ք[2?0<˵;xI-o;q0F#Oīuh&͚'RPi>IRH(!J!q"RB(,%24i"͉QyNu߰wQ~{uz]z磩0yH*j<ZP۠W~;h"}t![c mH,2s?wyJ~e#l^h(MzjNC^0<v>qM|oFϯhm'h}e9Q78o3Re;ЧIy m!Xe OjXgD ^1yum.gnD%w6_c\q픓+6xDn=x:82!A6@uşޅy9ZQf%ͦ#GDNԵr[P8ڢ7طy"!.m&r ˨t
-
-1۠Gn t|{ ҂ژ%Hy}'<|QT3
-` EsB|\miȋ31lcKLnFGN.͎W60XgF'Ɋp#Gry_*%CKF>4򇶁
-p|A` tս
-pU8F&n:pT! u}⨁;f>O)lmQXCA|&>M-oAno$+>76pyG \ntpdB6U
-oE>
-oFEVT#``$ȪX9FU+8lG'UK{,V;bRa'QLU5-pTtRw6UܦL*NmPFDž;/>W5uQExp7罏fg5vR *Emn=Kίh':ɥgˋTbWXgs#*1UTt4P503ʭ\ktwumW
-;T<Sn?OΫ
- 8'?T`@C\^
-8A/x8XVec6hcF9e䶞[En7FeAkAC5PY`%`*  rʩ"x'&%g=JB}×K q
-F[ |r|Z, 6ȉOةgbQFnbvi4if2>v[)A)19H,Z6O=z~k%ܹwlNPG&aϒrf\5]D2i!.֩1]mb}5/MuPF9wS_0JvT/ee93Hd+%C
-cI)$5B"(k%$%dm""ٲk_R~<"Ms sݟbbUes9>1}+hb
-\ln3:#*,4`4Ʒ(1,@~11E>#m R4TW.`w4p̙Ǿ U'p0
-zq Fcl8Z=0)`k1h|` 9Jk[x8&p
-jo(vb cw;C$vT?6FZJh2h`uB
-F$ =q@m$#>\w?'+UIJOx}G݃SU9Tpg\w>dUQRw<A \6nA-΄%d"ߍek&#h`dbXR
-L@׀k) GYghK,:H8@8p nifw*B>:}{??5|Xg-wL ptֺr',f+劬EE~=QIM3}؟no,zo^-%K8X,"8q:4>q96:^
- 6:׀_ew%9E}+G*-C>$(X%Q{PԭlcmAV?k#m⟚ԠAUw[؟
-MEяFХmCeQ c:>T *ث :_}?"ܴo{ Sԧ8^% *aaW
-u8H
-q_72ufPՁ@38\4] #*쾩S Wp,Yj 1iU7L@ >(;%*uxϙ?ဿj@'}4#ç8}]UrRc.T\eJv(?3bkP_DRrX;bҼq>'Qi,\
-Zʁ#9_g#* N- JuH)m5rI)l
-+BF8aRcuԅ[O_%10"mwk*J /uf1 |>;A!1UԷh3#=,(Is:ECiq2wF<s)6-5vƽA-*u'@L
-{c}Co8ϊx|qK-嵠۲48V@X;
-=X vm <;rH#8}/zPP^9q`0z m եF0~@MC
-!6Tg&EN/ bpH)jgt?nl#A޼,H 8>0H8RؤcrU μx`~R_Qx4jy?:x_M{V3PDe\(NBDʴ\}{G`xARhMl-6.r {D)̉Tذs*O; 2yl|Bɪn3s G pyόV#ɇqVJ%_#f(v$N0:snr+!2C.!TT5$CҀB,)ǐ"t3ʐ1CVfLd.i{=ޜug=-[o.#׷t LZ(Rggiϟ$߸bk,IcK~
-?mA9  Pj\8ni]AJd=/αG@TZqN.]WZ m9:bj0wK
-_M0ǒiZ;{!,^*
-V<F0L`-Uy7:ف*r֬ZW6XDVKVꮃv.烣ϯoǃj8`zIk}p^N@t7oob}3j|jnI 9Ϋ+@iT=I ww4١(S
-&Eu]#n~72јwx
-XǃAmȿ-jm
-?
-J@cOൄg(p\}$<M'mLd%.[ ?<`׮Sol{/1W"- ƀS#3z!]u%Y lLyZQܡchaz>Gc[=gb``%En`܊ v5߳MAJTp7uRjLOUPQ7jrb_|0K
-+g NV͆ÿQbjJk
-+މaSU[mzaIX<\|#Sr7ukm=-LӆzʼlPW m؂a~r̝⪆fjߋQ6gyT('ֵ`߳Gv| }KV 0<l񰴆Bƒ@p
->jsCU1*P?k+mRlAoӃoWGEL/" ;QE?RS0#)6"ȡ}Zf"?xqons/$VJvA.F>>B(iHVJMY~V ߳ǭLޮ(+ZX!IJ^UkiOTVx|[+Gx={,d܊
-s2* /S08cs<(. RXԜB}52 az7Y ѡ,PI)Hm)-E~xCPDRNyǞ&G]GZ}
-2O_ <of&hC}혰K^.z$֭``ƁW
-\RV.`X{ /\W2[Դt ̑OaicӬ /?R`k1`/Y]e̔hdq@WSUA.)#x,_ו,x5D )+[:{G&` X@" 1*IEQ^ƽЋ@WKm /YR k+!)Hxz_ w?53m2$`P@C v>*-IO rq\ Y A+8br'Dx~8xDM/4w a PY"tĄso1
-G2Sn߸w YId [L>>!~9 eUud {H& Ijٞ@joV'݌
- u?eoiOXxs-%/+^W@BaC&f0n‚*o~'
-: Dޒ$tRKV߱>by9Cmk
-r3Sc"}N9XTSƶ{[]a1)9EU= Mw @R3s J*([ک}@2jlLf
-" (
-j`Q1
-.뵭lu~g$_o`0y}ɛDx2?\_]Y;GMqs-jȏMLgHeu}s[Aȕkӷ?Xx_ϯ
-?7wG53=y} &qa6qf O&I%D9,-,#jX4721#YSml$&A.ّWP":TwhۉށsãʱS7gTgBݹ۪S7ǔÊ{;[ApgT*jfX׃tS$16 Z1(c3@'5M ߼+aϲExU^>195}sJu[JukёaŅ}=][VW-)
-q
-/GS0 gs
-398 0 0 398 6557.1162109 7246.1401367 cm
-/Im0 Do
-Q
- endstream endobj 862 0 obj <</CS 735 0 R/I false/K false/S/Transparency/Type/Group>> endobj 863 0 obj <</BitsPerComponent 8/ColorSpace/DeviceGray/DecodeParms<</BitsPerComponent 4/Colors 1/Columns 398>>/Filter/FlateDecode/Height 398/Intent/RelativeColorimetric/Length 20921/Name/X/Subtype/Image/Type/XObject/Width 398>>stream
-Hy<{KeXNǾeɞٲg:gR2D#˄K!B"Iɒ%Fi;s}<u?x>d@}S Z\~vVFFfFV
-;KWVeʯ;Ò
-dK$AA m pq 
- Pk!!A~>^^n.$.ˆ&$["?O)h 0`@daQ1 I,/++#-& @!`$ppmTT@b_PXDL\v+)kZ45  u5Ue
-r
-4
-Lu'STRQ'h[XYw8t?]]99pgkmeanjblEPWQRKD
-!<s..>1BJjZzFfVvvv
-~fef\HJ;}:2"D()$qC]Mu ᄉ,fRp I)hhY"/`RɈظԴ+WKJ+*Q(/+-Z| ?7'+#-59)!.6:*d()8쒖d_ ޏZI+ ,WR ;'7O߀`3s/].ZRV~f}C㭦۔n56߬V^Vr쌋ɉc#Ï}<\a$5%yY
-SǞ9v,$Dlhk(+YRF dSXθPT!Y;D<I
-sN!Q1\+,.khjik ~:ltl Jp=599||l KoOwg{[KS}] d$Łȱo7'{k3#]X,NTX0:@a-[JP'Q:H<q*:.bVuM-w:`hxdt ϼ?PWfg_΀  r܌į#N}+H ȦZńBBZNI] "E'7ģAp~1_XxwH ~[\|͛`f^LON`[o7U"9c"HANVZjx)1!4KFXefWT20w/OF&d_)Fc}b98DÇ?B ݀c4fTf_|$tuk%W2SbH>nv{0~nV+-8yĤ4t-|I@uv[Gw'C179, 0?C+m[Csd2?$Ϟ=jomRVjBld1P[m7 ۃbX K˫hZ;x"UuwL l=ʖRh M~x5?;3=9>
-"{mn*/s*4>=zJrp`rmXU\|B2
-چ{C#Ƨ u-]" 8 VVV,lxL(?Bܙ/]ؘhK Xg_kEP1?@<y&BF~QY}<8261=3 o OrƅB&A"d{rnZRlÎv{Ud$NQ恆B,,xIs_ܗ?hnsgJ)eI
-aR
-PMԡ\#ʈk%)#eKٳɚc> s络Tw9O<~@?8e C 
-l ٴ丘ۡ.gľ56c<|}5GtK
-Xw,t-)nqIJ 4L`B},8dzdldpWWLM޽y1'tKjpMK00urIJF^qEu=Jd's"$I $0'=9~D#X_D<x="$,xx I gw(jBZVA٫֎~H;
-!2# Ã}oj*J^d<pˇ*a>^T)oyxWIJG,<|&r^V74wP ?13@|Vz]UYAvZ5*,
-O_+n,Vqn:~m׭Y)H cp @yoTV۽99ƢݏbQAB^[YGps<avHwVE\W\Ā%$%e!nX_$?+yUGoXX`=(@X2:FyDx_65ܣa-3|" )U ¢/ 1UAx<wB\Noi+`/GN)?,)Ymz&V\CPYY E1b,@P@Ɔ0Źć<Zއt
-9.sJ`lP 28{~H-DY0b6,<E,IuPGa)11P0Ե Z;^S ;=G0{ޮ+=M5%<h\qRX0`3sjgY5>dncX]{'GOg;Tx,ۃ ʜԷ<˅İ`0=q%8_^vg ѡ<Z>Qeo+R -_f<4)WiU -]}C<~h,]]:g P[Z" K VR28jx/$QJVQe]SG =_&Gk^g$Qo]vw8~Do6-mšjVڨ
-FLBƶ#p_p4 sػ] U%iO!:ʲb8<X-ek+(ů[&&CY@̧ _3۹Yn+26R2J۴ (~QCoI(7~Ejk|]GxVUv.Kɩ5:}7(2S^of}6/LF\jgqhMbB`T~aR6Na4 hwzx}6o.M}|78JUNjՊWʀOZYZ̢ER3>6o(xs3ISͭ%ʃ.V4<v98*.5!)v]u$;%6'W;:۔rZy0X&sEu0Q0KRΦ'wC[j@y˃Spcj!\24 LO!,o1F`p# xLO¸n,Hq~<-^8Иk6(i۝ (574JfcluISj5sc[֭ƺp0ИZ).w{񸥰ƦD<*/-.*)sCm5 kifę`Q5>#&)Y
-)RпxeR_Q~u%iq4؍ʎ}&6^ԧ%1K1`/l$TǍt+p
-ooTCcvD;Yiʉ 3;h~@4~L! yk{L.?3hawG CmY1n`{.4cLfvAq9FyHmj?#?+)5Z2sؘh=;:- &mh}`F eI[ .@StC G`tҡ_L> 4f-lQK ̷G&eݸG3&񪮢,/#1wK%A3OIc>3w7ӫvK }\HA\ݩ̠J}{|3*;z~K3T[^zbQ]6V!H>JpAqyu];c oWԽBf>Q8#[iŊ6ЀuJuNи WK6xOf=_V?u%dŚe 狀bHt`eh+8\N`F?])чݶlX$5 |{ߊV|C2n|^AVRġMC$h!L\x O:|jy^y'/qg[Hr1Zc rj:&.3>mh~;8Lf񮯳qvXi)K
-\G nKAiv5V mg&+o
-Ǵiа~&^Ջ:ʲK G1tb9e,>ie-
-x A v|
-#++L[Pk`>a_W n93 6.go=k&Էߪ yo4Pf6Y!ȿWSdU=m eɊΦ"3sH`Sykw{O}[ \(;9gR%)!n6&[nAIEMK`j w7v0:O{lY.;p[Y5]S{p|jf|[ȋDX-[ %CU8P4ظa5]!GȟݿA EcSyw1w<a i}^QfւyԄ~ YF\).oNA0uyPꅅpFCnGϐ:hP47-oZ 씆 a`J)@8@0t~'Tcb4B2 Լ$N0yXy15 ~iOvK>~$aaTh,
-4>WύZF ە P(0$rP9`4,i"9R9(Jˌl\EѠZx8px9AI8M 3VPhfPO7)!n6Fr#+RCkgH5@£_Qr`q,3Ì*p&v^iUS#7ѠZuh$
-Y
-
-vHRR 4. ![dD88Z~<󕗛ػJϿW7HD:hkxRle(!Jg0'&x%g?o!Aqƥ`wS9d\Rno@̅w^vh[:aik(r6gq~NrJ.b8zM\h 1^~zlfpqpV. EMCkCiW˞h}G0zp ֗N:mJ
-0*;|^)y I G7Nzn]*#Bbd/ "J/w=ߺ"sf2EdȔS&D ET
-4g*J
-X eCDGwf6znkӽ z>|k|QcRѷt O)G-|?c#hɽsx\Q}:#cc.+ px4p8?l(M <.<>թ" ~:<|KjHC*-UEmMEǧ<U!jﯗ" ZrI?s
-:`=UHe}!#}qve&6.g?H/F<T=Uhz~ gkÕB\ xow {^R~NUokMqo7])'x$ [JzNI卝Q
-Ӣю&#BW$m+]? NAN觾vqcow3ՒYDOdmH*[>ۏ񎛝pFEq> iCXFhSWӊ`7&?%=* y-S;7cmgЎ;ZU}c\:N.;X(y7I6.h9șZA1xp I$qL8E_6p &8(C8Pm0)A`(@![SM9z
-@gcyNrbj&ER! b`|JTTCRThJe
- >6Ry̜BjF[V*4ʂ'.{W)Uh
-ɶn>}U+1AhRZUu Jjڻ=] "hVSs Vq9*.MM.kTm&Twƌ2)BA!>nfZr47$Vb302%MsGXp $ر^{(+- 07,x] XFcWSEnRţuy& 27$F+D`pDz: @SPZzߩk_V¹APh28& ?d ,msPGaZԕV*J6Gl1V2SD,@[xZCo=|G_{mq&И½dwHa87 yվz{㬋59-2w .m㏨`go;DCV8S iFGq]mj,[ h̚@Gtz;M]QAP(T1LcFWLaǣ“*>Ai|hٛjQLl:v H i@gCYv|-l|+t͝<#S^mAHX4 vJz.{RP38
-iF@#};Bc15 ƅt?]WH| )+Wӊ[{Rq aR]cԵ/k 2- FfNAF[Q h|iicQ3q9[vHiХ1%$nlrFS@AX(:H@?S2 h4Ӏ \?SɫiEխat?]BߐNK,v{]gpt &CObg`dʋ-݃#A!h
-q7Ք[2?0<˵;xI-o;q0F#Oīuh&͚'RPi>IRH(!J!q"RB(,%24i"͉QyNu߰wQ~{uz]z磩0yH*j<ZP۠W~;h"}t![c mH,2s?wyJ~e#l^h(MzjNC^0<v>qM|oFϯhm'h}e9Q78o3Re;ЧIy m!Xe OjXgD ^1yum.gnD%w6_c\q픓+6xDn=x:82!A6@uşޅy9ZQf%ͦ#GDNԵr[P8ڢ7طy"!.m&r ˨t
-
-1۠Gn t|{ ҂ژ%Hy}'<|QT3
-` EsB|\miȋ31lcKLnFGN.͎W60XgF'Ɋp#Gry_*%CKF>4򇶁
-p|A` tս
-pU8F&n:pT! u}⨁;f>O)lmQXCA|&>M-oAno$+>76pyG \ntpdB6U
-oE>
-oFEVT#``$ȪX9FU+8lG'UK{,V;bRa'QLU5-pTtRw6UܦL*NmPFDž;/>W5uQExp7罏fg5vR *Emn=Kίh':ɥgˋTbWXgs#*1UTt4P503ʭ\ktwumW
-;T<Sn?OΫ
- 8'?T`@C\^
-8A/x8XVec6hcF9e䶞[En7FeAkAC5PY`%`*  rʩ"x'&%g=JB}×K q
-F[ |r|Z, 6ȉOةgbQFnbvi4if2>v[)A)19H,Z6O=z~k%ܹwlNPG&aϒrf\5]D2i!.֩1]mb}5/MuPF9wS_0JvT/ee93Hd+%C
-cI)$5B"(k%$%dm""ٲk_R~<"Ms sݟbbUes9>1}+hb
-\ln3:#*,4`4Ʒ(1,@~11E>#m R4TW.`w4p̙Ǿ U'p0
-zq Fcl8Z=0)`k1h|` 9Jk[x8&p
-jo(vb cw;C$vT?6FZJh2h`uB
-F$ =q@m$#>\w?'+UIJOx}G݃SU9Tpg\w>dUQRw<A \6nA-΄%d"ߍek&#h`dbXR
-L@׀k) GYghK,:H8@8p nifw*B>:}{??5|Xg-wL ptֺr',f+劬EE~=QIM3}؟no,zo^-%K8X,"8q:4>q96:^
- 6:׀_ew%9E}+G*-C>$(X%Q{PԭlcmAV?k#m⟚ԠAUw[؟
-MEяFХmCeQ c:>T *ث :_}?"ܴo{ Sԧ8^% *aaW
-u8H
-q_72ufPՁ@38\4] #*쾩S Wp,Yj 1iU7L@ >(;%*uxϙ?ဿj@'}4#ç8}]UrRc.T\eJv(?3bkP_DRrX;bҼq>'Qi,\
-Zʁ#9_g#* N- JuH)m5rI)l
-+BF8aRcuԅ[O_%10"mwk*J /uf1 |>;A!1UԷh3#=,(Is:ECiq2wF<s)6-5vƽA-*u'@L
-{c}Co8ϊx|qK-嵠۲48V@X;
-=X vm <;rH#8}/zPP^9q`0z m եF0~@MC
-!6Tg&EN/ bpH)jgt?nl#A޼,H 8>0H8RؤcrU μx`~R_Qx4jy?:x_M{V3PDe\(NBDʴ\}{G`xARhMl-6.r {D)̉Tذs*O; 2yl|Bɪn3s G pyόV#ɇqVJ%_#f(v$N0:snr+!2C.!TT5$CҀB,)ǐ"t3ʐ1CVfLd.i{=ޜug=-[o.#׷t LZ(Rggiϟ$߸bk,IcK~
-?mA9  Pj\8ni]AJd=/αG@TZqN.]WZ m9:bj0wK
-_M0ǒiZ;{!,^*
-V<F0L`-Uy7:ف*r֬ZW6XDVKVꮃv.烣ϯoǃj8`zIk}p^N@t7oob}3j|jnI 9Ϋ+@iT=I ww4١(S
-&Eu]#n~72јwx
-XǃAmȿ-jm
-?
-J@cOൄg(p\}$<M'mLd%.[ ?<`׮Sol{/1W"- ƀS#3z!]u%Y lLyZQܡchaz>Gc[=gb``%En`܊ v5߳MAJTp7uRjLOUPQ7jrb_|0K
-+g NV͆ÿQbjJk
-+މaSU[mzaIX<\|#Sr7ukm=-LӆzʼlPW m؂a~r̝⪆fjߋQ6gyT('ֵ`߳Gv| }KV 0<l񰴆Bƒ@p
->jsCU1*P?k+mRlAoӃoWGEL/" ;QE?RS0#)6"ȡ}Zf"?xqons/$VJvA.F>>B(iHVJMY~V ߳ǭLޮ(+ZX!IJ^UkiOTVx|[+Gx={,d܊
-s2* /S08cs<(. RXԜB}52 az7Y ѡ,PI)Hm)-E~xCPDRNyǞ&G]GZ}
-2O_ <of&hC}혰K^.z$֭``ƁW
-\RV.`X{ /\W2[Դt ̑OaicӬ /?R`k1`/Y]e̔hdq@WSUA.)#x,_ו,x5D )+[:{G&` X@" 1*IEQ^ƽЋ@WKm /YR k+!)Hxz_ w?53m2$`P@C v>*-IO rq\ Y A+8br'Dx~8xDM/4w a PY"tĄso1
-G2Sn߸w YId [L>>!~9 eUud {H& Ijٞ@joV'݌
- u?eoiOXxs-%/+^W@BaC&f0n‚*o~'
-: Dޒ$tRKV߱>by9Cmk
-r3Sc"}N9XTSƶ{[]a1)9EU= Mw @R3s J*([ک}@2jlLf
-" (
-j`Q1
-.뵭lu~g$_o`0y}ɛDx2?\_]Y;GMqs-jȏMLgHeu}s[Aȕkӷ?Xx_ϯ
-?7wG53=y} &qa6qf O&I%D9,-,#jX4721#YSml$&A.ّWP":TwhۉށsãʱS7gTgBݹ۪S7ǔÊ{;[ApgT*jfX׃tS$16 Z1(c3@'5M ߼+aϲExU^>195}sJu[JukёaŅ}=][VW-)
-H #7
-d}4 !#чCۧOD_ϟGxt/p+u%nD_:M[C$ч2}0#_.N3 }<c/.4
-E6(BPd"+٠
-UV(BlPd*+Y
-E6BPd*+YUV(BlPd"TY
-E6BlPd"TY
-U6(B Pd*+YEVAlPd*YEVAlPd*+٠
-U6(B Pe"TYEVA Pe"TYE6B lPe*٠
-U6(AlPe"TYU6(AlPe"TYU6(AlPe"TYU6A Pe*T٠U6B lPe"T٠
-U6A lPe"T٠UVA lPe*T٠U6A lPe*T٠U6A lPe*T٠U6A lPeGlPe*T٠U6A lPe*T٠U6AUU6A lPe* <,(@ lPe* <,(@ lPe* <e>_ lPe* <e>_ lPeG~\U٠D\T٠Dq>\T٠F.alPe* |GA>\T٠_D.1lPe/#U67|*TYe>@ \=ʻS˼*<Y;{6rwVe#ycU۪eӵUeUQ.G.,B2o/E.f,b2oe둫7*yD.ު\=[x3rPe#y*yu#"WyuC*ymc"Wyi"yi*y]"WyY#yYC+yMc#WyM+yE#WyA#yA7T.j\k)rr[2U^ƍ˼[+y Fn\ P̴ ̬IˌV̜yˌʐ̘̈<e\ɘU
-\晰e\Ye\)eNсEp8:G~`tڟ_+CYGq$:GD'q_9 3/Gc~~ tʯ5CCs:@'|~ϢyS]A-:5[]E#+϶C{ f\
-usK~otwm>хƠ_\gǕmF\f,EYF\ˡ܃~u-t.Nq+EF:8:,yASgCg&ПϧзOE >E?2.p?5E}gB׸z"я24G.3}D u[c~mCt6Egjkt'7.-S@_sSDG}oE-*lQ`{أ&k-
-Hy<swk)a,c[ckK]R%e)BTԡVɉD*ʖȖ%[,Jۭ{۹7تxt۹ן13;"""~wLMEp;M&}Mk.Gz#ut8|2",&_A |;Ff`/6^ZdYY988vnbggceE∛Ƭ y!L/Z/]66v]ĹDEvDZ̹h"mcv1]n/
-5!K5E㙕΋tET\Bre2T'Reee-^")!.&JAHq)Ԅ/,80'
-.•WT)khjjiiϙ2MIQA
-Rb"B|<܋9'Y$=ůY1`د0EL\Rj U^q9073562]B[(Olq&3IwbOb$ )()͚vN]\]]f .8oprt_gfJKsScC}]mMu<u5:pi8IDd!1 eJ4U &f \7{nz5oV/M]{N- 8YzrJB1Ii9E
-
-aѲA~vr\3fZPD\ZVQy70$<Sgf^UR^USSF.ȾÇBd{$0X?{P[]y0*l:Ña^
-ʚz&Vk\=}ęW߫mlFa/../ Y#W/FA6pNQA^vFZm.-/灃ZSfK1u:B£q’
-qk{W/(
-_BšFXaAvzr|LxϒLhB׮EΙcAq)m* w
-OF)FZ;CfwO܌i ֦U
-#C\[LPٶIFJ\DP
-wil/ݼUPu1#oIcҟnoixV]Qs#츾pFq?j50»XȸGP]}Q3!fH1Ն]{;⺯ @[m'\Ӧr YO5_?͆i['Ok[;{̈'0#i0Ɔ= u%yB=lM DAx3gi"k`ÇE0s UXVY 1Sç5]4huqC<lOg5"KA<S8cH<|.GZ 3vƌӲ@ 0SO*QA& nyQ JF (+%|ɂ3ygpi;s%ťdaWcƗqbZNqyu}S[5xQO&'aƺ4
-gsc}mUM2Bmeb!QIMʪq,f\SO$c47zd8YOkvuW.[4m63uY#Y[lu
-jۢ>MS\QSߌSb<iG7744ww{S} ✈9ېTQ -LhL 25%H6xs7"UOjč97T<{8Z2صYVJLig:[0΃d-,&%y)kGP\?c|@#qqt5M둶g+13y?MjZMg<@0z ~čV4ΰR[߃ k03<TQ.XH{Xػ\JH.*G}EbL?8WeEz9ےtam ̛Ǟqf<XHֺF$[g";]Me<MT_ #
-U߉sw{c]ei^zbLV9)1lgF KmQ3w IL+k0FęP$'5>2Xa+hq31̓Yd:eCf6^A9%kں#ar_gˋLmwZ{׈A;&&l=k:L֢',ܑ3 k^tن1:緯G^v4W'Fؑ# cG63fχiوd_VUrh[aq=@w[#vkV'8C; qfukSm kB?n٭yfuc[mÜ?9 k;#)693%p'aq ٹ#y7NC8gvܴΞv*')l1X3<|hv^=3WoƧ>kYBg+YӏA O+2oQ⬮qy,nmg΅%%W)1IO٭g;aO huB_sf<Xڸ
-f>wK-I52vXaD] nbikJ'd ټ{ɳN^ףQ#C{Pٲeyi<ءV[%1*5Z^I!/vJ42dUmXa(I1֦GTڰg`9+_@H\Za>]3"?y'r + 975.AU%y rL x`kSkg'Ϛ: SVD#G65 O $F]v4>OyТM]W,uC97<vsH#3EAu%n\65ܥNBX6]SPPTjvuQ
-+j{_9<4psfjقʙ6Z$$wuv ]dhq!v4H
-<oq쐪䊥 <9S*.auPG~uWVf79!4ɱW.X@9oX#
-56m\%e!jl^ Gy=aکB9SAZl`0'7fvcPAIOꚻ Ga>dnvM`GE@ z6u]c WBn!5ؚ_ĝ|OSݤ#GBCYBEc\ELddI]
--x ),Ckɾc_ᖚ~s;LWg{~ޯ7ZW^9>줷
-Tm^Td2k-wG'n_k~?5?I/# ޼xcJU% dƂRrxW\Rƃe-}C Θkӛ^,{+!/e&Uj
-҂j>s?^Ϧ׵u ךjOh.}{fc`QE%!kZ;y x#!T~p_Ɔ;[k˞=H =vp:lQ "fdrw5@%k֬`=62VW^LJ}YTys 3;d-3[>A@n`V2~YA6,
-jϩڠ$')&"p?lnL=IiMKg?dd~? YhUܸ b-d_p̵@[Y`  Qwrw1T& O!oؤ|(w{ UWE~J lkf,0
- dC
-nAUi_9YPL ǥdP+h=\<8@XTOg\ #`ePAsrv.(\95,膋*?3)6
-CY0iO~phMZr
-
-EA1Ow4UQ)jamU3ryA^kȩ/[
-L)CemvպmιmX{W?x<tV_CQ0z;}ZPdjA舢2 幉Of{R[MVa FQ/ai&w%w~ zB춚1\-T~elz ̝}gU^͠M4WF]xZoJ |1 xOD_Oce xX#La`FՋi ^nc3ն} P^Ő:{(ogs Eq~Q/Z6^Q9TR *[z?gzj`' o"SFLZQ̜BR5I98> k w@{mI&"`Fvnزk4:y?ի 5 poseAJdUS?o[5^QZ'l܋HzתqHJܭ~9c+'2,8s.7Cb^ gNަG~^y1^6e  e.aUvW4yCܗ69 )NfeLFYBiøA2Wσ}5fQQ1Z@X|OӇ<xMٜRb߰tI(s(.kEtM3)J/fMʲj:fW
-ZfFTE~ʳvڪ2\,KyY^
-|l ZʞCYFMc 3t!="%DGʞ~#K72  欸\hȋ2lXHQgQ(c+$Z+ Rfcrx׎[_k֬zZeqF9e @Y;K3cB|+u"TBҪڦv^
-p0n\̰{e`Sw (c)fOvԕ~#",q/:-[vkZXPNʞ8M;V(Io^ #*OجR2W@{mq`&#LOWFf#+T
-.l:&NhF9\ڎA
-h_kUAӀ+7f݋WL^M=f>i"a]fL2(9ڥibͨmc{a+0S#y1_q3,^>!Ȍ30/_<=9>؁){SmȿP_pae`똕݈ʖQ00*ωu9 _6^[TM!zUR@[!g.F݋GTn99(c,15U_
- Sj2BU6Z؛<d|᷀gm{1fȿZ`la!/JIe)Gz^̬Gzښhࠤf081w&,;6ua.W69$wizFՠ
-{Ak2?鉿NA&63N>exȽ>ؿA^'g [Lgd$)o(llЛPeRP
- [Z0ȿ*;&,T>q=Pa1g:eG
-VvSyŕ"g@ac4KlRas6(l\,{6 <İAac:l'e9YHa3oW4 J̫'w.[EyXUk@SHZUwHlVYc7(lLi`GmqzTv~v<hY38(16CƲoSB^0#gO\q+iE5ReT%>s;oOn7 =ͺ3iG حep҆n<(ll\5EiWTccX0#gKXV][a {G&᠕n(|຃- (#Kw䂪IPsbCnBحKge-L:;C;*:s@ Prʞh*Hw4BԂ>9T.vT(lz"a8#RƇvJ/x./߀&{-|㢙 ƯfYVYy}RX>023޼ u1?yY6
-~URׅ'y|0]+#‡>˴Ig;$6>`Ga?Ȗ"J^Ey٘|0~J
-(KM%˂tDMPX JzAP09{Mt=g3s]W%! \]H,ffzrż\<js׊XM.^[3jyXƇԲk@tJ~eXB(ў/:b'[ZƱʪygעZ%\j"MA-S2mݱ"n5tZ#\[eg&+Ê[_cd{{Gk< }!pgCYNRĹ'ޱ)(c0olf2ʋߔ?w#{/L-,z#(6m`2$yaf2/9
-,Rm[h*ogVѳr I+i@\R3zKN
-|쌴N)23Q tHA)R0
-RPJM [bߴVy3>q#萂)xwCu%Bl)MLu!~z7= H;JɊ0eU[9l{^nESۙH
-|MyQYOxRNR1_Dy# GDVlxbvYC0R._WބcU3K.Ŕ!e * ;,!)Õ`xe[[YÓH|2Nգ^!2K;2t!*`kLs PDʐf2=5eϐ: _EqAz*҂dxg eW#(YH*Sc=r;Q1=Pn)L tUƔ*3q
-JӳvK/m@ʐei3Ph.HpQ
-i*Р RH$dPdqoEua۶}z׿ps}m7Аo?*hZ;܈{KkhW[*?޿h.+H&6^y ;^M/n[Dl}yb7aj<K4 e^Us7yd ZFj}s]UiA.?ѵ#$;~&"ZSЖ:˲߽tbeR9Yh-(ga򾢱D ZO;J p۳yRI-s!k~΁oPˠfׯ>^[wd?3?Y8T_| -e<}h8;3-sK,]cxے+@ԏ/_u6R]4ef>qUƻ\QT7ZSF{ZcqڱAS^H-g`f_$eh{3/#?d'prwSUWO9ZX"H2$Ll"v8^P38^)R1
-"7%&źB[f^/󪚺QG@g}yNRT~s]UiA.yZfd]gpLJnEc -wԕf=s}fmIN.AiU]QIQT{mqfBQ;5, t-wf~
-|1O^ OSbB,kztu֯F" .pG]gN7UAKoQI9@pxeć3]Tr&/{"ߖԶ CFY.Hli E/qƻ\zK+f\:Ɗr2Аec&_4_qә򪚺`q,e?q`7Y+um^1)?5taCh\lZYf/Ζ}/F>*7 Agգ6,<aP^cȅO@ ruYh6H0)hmtf"fgb,S 惞90dc;,\Ge.LL7tD$-m3{BnOlYƶnƽ Agy{!ގV2mEWlSs+Hx?kiֳK'f#$\oߕudc;5͓ڙY*)2,<R*kMw Ka;)$bSeˇ84R}afW\ih}*$
-@63Ge'EyܦDxYF+RAI(A˘
-VJwcLZ0,S)VnrO,irhO(UJ*#GU0
-ʼs)i8a^U6/19 =ODʬ9u#- dD823/U~A/8X'{ T"|f
- _;O_SSoY'ポ^ce.+|!c7Rs׶M1:gT_kջCKEjEl
-g 4uԁV& p/qR7Z?02!UY]'S,)~vR_UzEиpLX@aΨ̤3wLKQBpA\^dɹc
-Akzrt=Q[.]{0VշDՔխ}#D3ku=Ou1Ql^lL9y~;#*P+MKfQw/BƔ-:eIM[(q!\Y,9.; ]e0R^aLtғOMC_!,
-_'^8Ql @yvL.]vG@čԜ5fro碬WnZE3ˡO * ,
-_ukA63'7ALNhþo>)0@fe͖( r/2\|Rʺ+mw`gvX.(/pF`fc!k߾#)33QV Q9ETt-vhvcI33<e?2Vٜ<@KjF& L ^߿}i,ؘ0K0_N|[afj&"(JOD,(c
-|f}eW`gfF(7U>K;,( >J[Cgd}v6sq47- /jfm{]KysKW/ݍދ sݴJ_,|R:ֻ~eui(`&FڪKrRoFz:n0efd˹+
-+{ f&]mg*-B (l̒JfJL-m!BcBpm*~x="`zcMy*QF- &f`/4OȚWT7ݾtv?5(/WHBqg/K5;Pn,zoGn]k!'NeL
-ضXSE 3']S|'͇Q"l׭%9z6AV7E ,$k
-+fTH}=Q1/3)&Q/uZ(3k
-]ާrJ[ag3.}]Y<%><`vD$ig*`n~!1Iyag3,}>7-bAg[ =zeJ2rv62ƆoY\C^2.`2z>AH};AA<=9u̴i׋0C:{-wag3,S>.j2bN"RJf u4<3}>婉6}-Ļv}l9 _35ql0 5fR"l<2y(Pt)|D T<Z_M} leggV4v ag13?5^[&#)&ߍ4U/ҙ):`9%U-=CgGΆO_ }^0.٨g$e)mnQ͟e޼pެ_ʳ <q_@ص:F' _3=B~Ȉzîk~M^ 2jz6ާ.|)߿Fԓ{qz8l0RO_gfG=[^c{ÿFJs
-{̴'Ч F^;uUeDؙT2q\2j L`O>`DٽP]N\^}]lQU]sk'Y#S4n^|9}:cME a>.z5~f ,7E%fU6v @Ѧ]fuyW~;QҢh_xgs K(j9 ^sNIUs1|4 v)`^ Yϟ8fw1ݞ2~fDqllRҚ^h`̏ʢԄ W5]ż`Nꭴv<~5Iއ:kUЧ<WUIN`?7)"#}l0 V9{ml^=53bne"MEqs"sJQhC/&(hMG&WN zؕ9%"e~;b`i9şpцg:$o/JyҀ1ŐykVY/>_C$*4!a59hTBqNr!#FNIu{!zwxΓy_ИYUh
-# t՗e$Dy;W_CIfFL3ň9܋K.nBDc!P=m ;Wmoߨ"')71aL10mcӞא)Amzr4
-̜Q(# L\FQ]o'_/mB1
-\+h<$R?c_(C]-%y,kMe 6/
-fxŀhoeaM$2~
-99&ݑ`(#!~(I6+
-0kBqw}E DW]IVR@ y`c'!C/)kS] eYI~䇚 ì28
-Y@e\Շc~ɐ{;kK EyC@3|~h)L/#-dv<6f9oÌsio. [B.cb&rKk;{Q9 z(`_7A _htRfnIMSGQPYq՞`̘G`V
-q32d
-f.~aemuߑ_+@omi6[W.L~Q]Xl\ <},$tM{\}>My_ZZ{j6?d\?a[GCE^z237+T5t|~,ƶ)ôm]_QlJInٜ c&yb@́] NL)mǙ|H[זgq~íd
-U f/ dwukrOGK}%Xku?SN25q/&-~sl6wC cIۦ 2R֍e"]p1߭qj$OcI48sk/sxaQos+[ ~fyF1k+
-ߓR?loo6uKā[Sښi!c Z6JZuY3 ֕s>.Eb[3w[6<yWKBPжYi) Fʚ(8 
-]s[3y[6*a9X:y\u?&XXq%mlY3-ζr#9<dE9]8Zo)x;ͬ흽V7 <LǸ8AN
-t)O5E9I1~6:ʲbdidbq ;{E%=y_U C>Nh<kˋr3co^dki|`ʶpZO 3!Ϋ *Z;܁\PF"jMO0n(~(%."sPZjқ7ii`+
-lݦqūask(US%Ќjq|d*kM׬y5cXq^x9\ajw\Co")hfUxwv`7#yW-[4L f;3OKW&&[ #R#>ګ<{Y
-RsqΛ}=cEV
-KG;(2HAX{fV5Zcoq\錅 \֨?̓L`<N.\ۢT1qp ̜— -=zq^b۱#h}]m턌YˣZdŅ&A&g߸EZAuG7ȸҪ&8Ġf4"u<Hlm$\.e9 aXe=L 3\a еf&1E5M}IzqoM1FUMh~Yݰn0^9Cʚ9sJ+ <&1-YQYu}3[߸ĸxb ;#9.\ "1^3YCmz^+("!ͭ=oNHɄ⮬%@ = [H3A1li)ARlD7lƫZgF뙓k 7ᬩgdfuop$*rRF47)b:1jA*1TunVZbLx\ ctX/@ y&5k03>ð>]CNnѿ>A =I4xxPS9TuxF5kpm0|2;5t<w<uMmw|}-OB tk+K!Fz\>oejjB6z<|bwkYx+/I
-YtCSk!=4 &s鼄/FQ@Bz:Ôب@kΎv͎bMJLXe~1kC8\Wشy=z-9\  .-F]=}PT#kYX3~"^(vwkK
-'D@ hVQ^h!|Ɵ3ZШqŤU59aim}_IstUM=Acӵ7cuO1z /;48@ :ReYIa~㇩{_Z{v*In$ȿf%T5ճ_97
-4|ZJHoYMc?$e~1 IiHT@nnmk5 ڈ{ 93 U=w
-OLNz_X\ZVQE얶vOPTm
-4jnWTٵwacK+[K.^a0:t)I
-;%M_TRQ 7nv#cS3s ^Y[{? u~
-/劁#B ldLu5ɪJ %ZV^QIM5064ٍ&E.Ҋm7;:{zo3844<<<44xޞΎm7Z[j*J
-sEDpqdl43c4b5
-XVKM+ _:Hưa;s|B"qI_PxjuMm]Ʀ렎jmxjUeEyYI‚,MMJD==\ٶL+lFFN%&hbim9
-9N\/ 84<2:6>19Ux.(3+BNnKEWKJJK\s!;+St>0591>6:2<48;[Zji a|؝5A/ c4t LiVLՃ  '$&%gD"QFzlJrRbB|\\l *2<,48כpuvd۱lЂ:tB{o >$'-!B¨̂ΰl).ϋ
-9-QaC|}|/2t 3`pц&IHKaԪd!`e[3OG'gW7w'˛yr=\]8l{;I%x 'zXFR'wi1"]#llC#cS3s n`XY0Yp8lPe1m K:faanfjldhGP_Uetw0A|ƩѪedp) :T>B7u`AQ: 4_^`BoWzF*$L!tL"V5
-L&TUU.΋|ߨmi]#lX".V'U1VE'ee?&]85k 1n
-q
-/GS0 gs
-486 0 0 480 6513.1162109 7207.1401367 cm
-/Im0 Do
-Q
- endstream endobj 868 0 obj <</CS 735 0 R/I false/K false/S/Transparency/Type/Group>> endobj 869 0 obj <</BitsPerComponent 8/ColorSpace/DeviceGray/DecodeParms<</BitsPerComponent 4/Colors 1/Columns 486>>/Filter/FlateDecode/Height 480/Intent/RelativeColorimetric/Length 25812/Name/X/Subtype/Image/Type/XObject/Width 486>>stream
-Hy<swk)a,c[ckK]R%e)BTԡVɉD*ʖȖ%[,Jۭ{۹7تxt۹ן13;"""~wLMEp;M&}Mk.Gz#ut8|2",&_A |;Ff`/6^ZdYY988vnbggceE∛Ƭ y!L/Z/]66v]ĹDEvDZ̹h"mcv1]n/
-5!K5E㙕΋tET\Bre2T'Reee-^")!.&JAHq)Ԅ/,80'
-.•WT)khjjiiϙ2MIQA
-Rb"B|<܋9'Y$=ůY1`د0EL\Rj U^q9073562]B[(Olq&3IwbOb$ )()͚vN]\]]f .8oprt_gfJKsScC}]mMu<u5:pi8IDd!1 eJ4U &f \7{nz5oV/M]{N- 8YzrJB1Ii9E
-
-aѲA~vr\3fZPD\ZVQy70$<Sgf^UR^USSF.ȾÇBd{$0X?{P[]y0*l:Ña^
-ʚz&Vk\=}ęW߫mlFa/../ Y#W/FA6pNQA^vFZm.-/灃ZSfK1u:B£q’
-qk{W/(
-_BšFXaAvzr|LxϒLhB׮EΙcAq)m* w
-OF)FZ;CfwO܌i ֦U
-#C\[LPٶIFJ\DP
-wil/ݼUPu1#oIcҟnoixV]Qs#츾pFq?j50»XȸGP]}Q3!fH1Ն]{;⺯ @[m'\Ӧr YO5_?͆i['Ok[;{̈'0#i0Ɔ= u%yB=lM DAx3gi"k`ÇE0s UXVY 1Sç5]4huqC<lOg5"KA<S8cH<|.GZ 3vƌӲ@ 0SO*QA& nyQ JF (+%|ɂ3ygpi;s%ťdaWcƗqbZNqyu}S[5xQO&'aƺ4
-gsc}mUM2Bmeb!QIMʪq,f\SO$c47zd8YOkvuW.[4m63uY#Y[lu
-jۢ>MS\QSߌSb<iG7744ww{S} ✈9ېTQ -LhL 25%H6xs7"UOjč97T<{8Z2صYVJLig:[0΃d-,&%y)kGP\?c|@#qqt5M둶g+13y?MjZMg<@0z ~čV4ΰR[߃ k03<TQ.XH{Xػ\JH.*G}EbL?8WeEz9ےtam ̛Ǟqf<XHֺF$[g";]Me<MT_ #
-U߉sw{c]ei^zbLV9)1lgF KmQ3w IL+k0FęP$'5>2Xa+hq31̓Yd:eCf6^A9%kں#ar_gˋLmwZ{׈A;&&l=k:L֢',ܑ3 k^tن1:緯G^v4W'Fؑ# cG63fχiوd_VUrh[aq=@w[#vkV'8C; qfukSm kB?n٭yfuc[mÜ?9 k;#)693%p'aq ٹ#y7NC8gvܴΞv*')l1X3<|hv^=3WoƧ>kYBg+YӏA O+2oQ⬮qy,nmg΅%%W)1IO٭g;aO huB_sf<Xڸ
-f>wK-I52vXaD] nbikJ'd ټ{ɳN^ףQ#C{Pٲeyi<ءV[%1*5Z^I!/vJ42dUmXa(I1֦GTڰg`9+_@H\Za>]3"?y'r + 975.AU%y rL x`kSkg'Ϛ: SVD#G65 O $F]v4>OyТM]W,uC97<vsH#3EAu%n\65ܥNBX6]SPPTjvuQ
-+j{_9<4psfjقʙ6Z$$wuv ]dhq!v4H
-<oq쐪䊥 <9S*.auPG~uWVf79!4ɱW.X@9oX#
-56m\%e!jl^ Gy=aکB9SAZl`0'7fvcPAIOꚻ Ga>dnvM`GE@ z6u]c WBn!5ؚ_ĝ|OSݤ#GBCYBEc\ELddI]
--x ),Ckɾc_ᖚ~s;LWg{~ޯ7ZW^9>줷
-Tm^Td2k-wG'n_k~?5?I/# ޼xcJU% dƂRrxW\Rƃe-}C Θkӛ^,{+!/e&Uj
-҂j>s?^Ϧ׵u ךjOh.}{fc`QE%!kZ;y x#!T~p_Ɔ;[k˞=H =vp:lQ "fdrw5@%k֬`=62VW^LJ}YTys 3;d-3[>A@n`V2~YA6,
-jϩڠ$')&"p?lnL=IiMKg?dd~? YhUܸ b-d_p̵@[Y`  Qwrw1T& O!oؤ|(w{ UWE~J lkf,0
- dC
-nAUi_9YPL ǥdP+h=\<8@XTOg\ #`ePAsrv.(\95,膋*?3)6
-CY0iO~phMZr
-
-EA1Ow4UQ)jamU3ryA^kȩ/[
-L)CemvպmιmX{W?x<tV_CQ0z;}ZPdjA舢2 幉Of{R[MVa FQ/ai&w%w~ zB춚1\-T~elz ̝}gU^͠M4WF]xZoJ |1 xOD_Oce xX#La`FՋi ^nc3ն} P^Ő:{(ogs Eq~Q/Z6^Q9TR *[z?gzj`' o"SFLZQ̜BR5I98> k w@{mI&"`Fvnزk4:y?ի 5 poseAJdUS?o[5^QZ'l܋HzתqHJܭ~9c+'2,8s.7Cb^ gNަG~^y1^6e  e.aUvW4yCܗ69 )NfeLFYBiøA2Wσ}5fQQ1Z@X|OӇ<xMٜRb߰tI(s(.kEtM3)J/fMʲj:fW
-ZfFTE~ʳvڪ2\,KyY^
-|l ZʞCYFMc 3t!="%DGʞ~#K72  欸\hȋ2lXHQgQ(c+$Z+ Rfcrx׎[_k֬zZeqF9e @Y;K3cB|+u"TBҪڦv^
-p0n\̰{e`Sw (c)fOvԕ~#",q/:-[vkZXPNʞ8M;V(Io^ #*OجR2W@{mq`&#LOWFf#+T
-.l:&NhF9\ڎA
-h_kUAӀ+7f݋WL^M=f>i"a]fL2(9ڥibͨmc{a+0S#y1_q3,^>!Ȍ30/_<=9>؁){SmȿP_pae`똕݈ʖQ00*ωu9 _6^[TM!zUR@[!g.F݋GTn99(c,15U_
- Sj2BU6Z؛<d|᷀gm{1fȿZ`la!/JIe)Gz^̬Gzښhࠤf081w&,;6ua.W69$wizFՠ
-{Ak2?鉿NA&63N>exȽ>ؿA^'g [Lgd$)o(llЛPeRP
- [Z0ȿ*;&,T>q=Pa1g:eG
-VvSyŕ"g@ac4KlRas6(l\,{6 <İAac:l'e9YHa3oW4 J̫'w.[EyXUk@SHZUwHlVYc7(lLi`GmqzTv~v<hY38(16CƲoSB^0#gO\q+iE5ReT%>s;oOn7 =ͺ3iG حep҆n<(ll\5EiWTccX0#gKXV][a {G&᠕n(|຃- (#Kw䂪IPsbCnBحKge-L:;C;*:s@ Prʞh*Hw4BԂ>9T.vT(lz"a8#RƇvJ/x./߀&{-|㢙 ƯfYVYy}RX>023޼ u1?yY6
-~URׅ'y|0]+#‡>˴Ig;$6>`Ga?Ȗ"J^Ey٘|0~J
-(KM%˂tDMPX JzAP09{Mt=g3s]W%! \]H,ffzrż\<js׊XM.^[3jyXƇԲk@tJ~eXB(ў/:b'[ZƱʪygעZ%\j"MA-S2mݱ"n5tZ#\[eg&+Ê[_cd{{Gk< }!pgCYNRĹ'ޱ)(c0olf2ʋߔ?w#{/L-,z#(6m`2$yaf2/9
-,Rm[h*ogVѳr I+i@\R3zKN
-|쌴N)23Q tHA)R0
-RPJM [bߴVy3>q#萂)xwCu%Bl)MLu!~z7= H;JɊ0eU[9l{^nESۙH
-|MyQYOxRNR1_Dy# GDVlxbvYC0R._WބcU3K.Ŕ!e * ;,!)Õ`xe[[YÓH|2Nգ^!2K;2t!*`kLs PDʐf2=5eϐ: _EqAz*҂dxg eW#(YH*Sc=r;Q1=Pn)L tUƔ*3q
-JӳvK/m@ʐei3Ph.HpQ
-i*Р RH$dPdqoEua۶}z׿ps}m7Аo?*hZ;܈{KkhW[*?޿h.+H&6^y ;^M/n[Dl}yb7aj<K4 e^Us7yd ZFj}s]UiA.?ѵ#$;~&"ZSЖ:˲߽tbeR9Yh-(ga򾢱D ZO;J p۳yRI-s!k~΁oPˠfׯ>^[wd?3?Y8T_| -e<}h8;3-sK,]cxے+@ԏ/_u6R]4ef>qUƻ\QT7ZSF{ZcqڱAS^H-g`f_$eh{3/#?d'prwSUWO9ZX"H2$Ll"v8^P38^)R1
-"7%&źB[f^/󪚺QG@g}yNRT~s]UiA.yZfd]gpLJnEc -wԕf=s}fmIN.AiU]QIQT{mqfBQ;5, t-wf~
-|1O^ OSbB,kztu֯F" .pG]gN7UAKoQI9@pxeć3]Tr&/{"ߖԶ CFY.Hli E/qƻ\zK+f\:Ɗr2Аec&_4_qә򪚺`q,e?q`7Y+um^1)?5taCh\lZYf/Ζ}/F>*7 Agգ6,<aP^cȅO@ ruYh6H0)hmtf"fgb,S 惞90dc;,\Ge.LL7tD$-m3{BnOlYƶnƽ Agy{!ގV2mEWlSs+Hx?kiֳK'f#$\oߕudc;5͓ڙY*)2,<R*kMw Ka;)$bSeˇ84R}afW\ih}*$
-@63Ge'EyܦDxYF+RAI(A˘
-VJwcLZ0,S)VnrO,irhO(UJ*#GU0
-ʼs)i8a^U6/19 =ODʬ9u#- dD823/U~A/8X'{ T"|f
- _;O_SSoY'ポ^ce.+|!c7Rs׶M1:gT_kջCKEjEl
-g 4uԁV& p/qR7Z?02!UY]'S,)~vR_UzEиpLX@aΨ̤3wLKQBpA\^dɹc
-Akzrt=Q[.]{0VշDՔխ}#D3ku=Ou1Ql^lL9y~;#*P+MKfQw/BƔ-:eIM[(q!\Y,9.; ]e0R^aLtғOMC_!,
-_'^8Ql @yvL.]vG@čԜ5fro碬WnZE3ˡO * ,
-_ukA63'7ALNhþo>)0@fe͖( r/2\|Rʺ+mw`gvX.(/pF`fc!k߾#)33QV Q9ETt-vhvcI33<e?2Vٜ<@KjF& L ^߿}i,ؘ0K0_N|[afj&"(JOD,(c
-|f}eW`gfF(7U>K;,( >J[Cgd}v6sq47- /jfm{]KysKW/ݍދ sݴJ_,|R:ֻ~eui(`&FڪKrRoFz:n0efd˹+
-+{ f&]mg*-B (l̒JfJL-m!BcBpm*~x="`zcMy*QF- &f`/4OȚWT7ݾtv?5(/WHBqg/K5;Pn,zoGn]k!'NeL
-ضXSE 3']S|'͇Q"l׭%9z6AV7E ,$k
-+fTH}=Q1/3)&Q/uZ(3k
-]ާrJ[ag3.}]Y<%><`vD$ig*`n~!1Iyag3,}>7-bAg[ =zeJ2rv62ƆoY\C^2.`2z>AH};AA<=9u̴i׋0C:{-wag3,S>.j2bN"RJf u4<3}>婉6}-Ļv}l9 _35ql0 5fR"l<2y(Pt)|D T<Z_M} leggV4v ag13?5^[&#)&ߍ4U/ҙ):`9%U-=CgGΆO_ }^0.٨g$e)mnQ͟e޼pެ_ʳ <q_@ص:F' _3=B~Ȉzîk~M^ 2jz6ާ.|)߿Fԓ{qz8l0RO_gfG=[^c{ÿFJs
-{̴'Ч F^;uUeDؙT2q\2j L`O>`DٽP]N\^}]lQU]sk'Y#S4n^|9}:cME a>.z5~f ,7E%fU6v @Ѧ]fuyW~;QҢh_xgs K(j9 ^sNIUs1|4 v)`^ Yϟ8fw1ݞ2~fDqllRҚ^h`̏ʢԄ W5]ż`Nꭴv<~5Iއ:kUЧ<WUIN`?7)"#}l0 V9{ml^=53bne"MEqs"sJQhC/&(hMG&WN zؕ9%"e~;b`i9şpцg:$o/JyҀ1ŐykVY/>_C$*4!a59hTBqNr!#FNIu{!zwxΓy_ИYUh
-# t՗e$Dy;W_CIfFL3ň9܋K.nBDc!P=m ;Wmoߨ"')71aL10mcӞא)Amzr4
-̜Q(# L\FQ]o'_/mB1
-\+h<$R?c_(C]-%y,kMe 6/
-fxŀhoeaM$2~
-99&ݑ`(#!~(I6+
-0kBqw}E DW]IVR@ y`c'!C/)kS] eYI~䇚 ì28
-Y@e\Շc~ɐ{;kK EyC@3|~h)L/#-dv<6f9oÌsio. [B.cb&rKk;{Q9 z(`_7A _htRfnIMSGQPYq՞`̘G`V
-q32d
-f.~aemuߑ_+@omi6[W.L~Q]Xl\ <},$tM{\}>My_ZZ{j6?d\?a[GCE^z237+T5t|~,ƶ)ôm]_QlJInٜ c&yb@́] NL)mǙ|H[זgq~íd
-U f/ dwukrOGK}%Xku?SN25q/&-~sl6wC cIۦ 2R֍e"]p1߭qj$OcI48sk/sxaQos+[ ~fyF1k+
-ߓR?loo6uKā[Sښi!c Z6JZuY3 ֕s>.Eb[3w[6<yWKBPжYi) Fʚ(8 
-]s[3y[6*a9X:y\u?&XXq%mlY3-ζr#9<dE9]8Zo)x;ͬ흽V7 <LǸ8AN
-t)O5E9I1~6:ʲbdidbq ;{E%=y_U C>Nh<kˋr3co^dki|`ʶpZO 3!Ϋ *Z;܁\PF"jMO0n(~(%."sPZjқ7ii`+
-lݦqūask(US%Ќjq|d*kM׬y5cXq^x9\ajw\Co")hfUxwv`7#yW-[4L f;3OKW&&[ #R#>ګ<{Y
-RsqΛ}=cEV
-KG;(2HAX{fV5Zcoq\錅 \֨?̓L`<N.\ۢT1qp ̜— -=zq^b۱#h}]m턌YˣZdŅ&A&g߸EZAuG7ȸҪ&8Ġf4"u<Hlm$\.e9 aXe=L 3\a еf&1E5M}IzqoM1FUMh~Yݰn0^9Cʚ9sJ+ <&1-YQYu}3[߸ĸxb ;#9.\ "1^3YCmz^+("!ͭ=oNHɄ⮬%@ = [H3A1li)ARlD7lƫZgF뙓k 7ᬩgdfuop$*rRF47)b:1jA*1TunVZbLx\ ctX/@ y&5k03>ð>]CNnѿ>A =I4xxPS9TuxF5kpm0|2;5t<w<uMmw|}-OB tk+K!Fz\>oejjB6z<|bwkYx+/I
-YtCSk!=4 &s鼄/FQ@Bz:Ôب@kΎv͎bMJLXe~1kC8\Wشy=z-9\  .-F]=}PT#kYX3~"^(vwkK
-'D@ hVQ^h!|Ɵ3ZШqŤU59aim}_IstUM=Acӵ7cuO1z /;48@ :ReYIa~㇩{_Z{v*In$ȿf%T5ճ_97
-4|ZJHoYMc?$e~1 IiHT@nnmk5 ڈ{ 93 U=w
-OLNz_X\ZVQE얶vOPTm
-4jnWTٵwacK+[K.^a0:t)I
-;%M_TRQ 7nv#cS3s ^Y[{? u~
-/劁#B ldLu5ɪJ %ZV^QIM5064ٍ&E.Ҋm7;:{zo3844<<<44xޞΎm7Z[j*J
-sEDpqdl43c4b5
-XVKM+ _:Hưa;s|B"qI_PxjuMm]Ʀ렎jmxjUeEyYI‚,MMJD==\ٶL+lFFN%&hbim9
-9N\/ 84<2:6>19Ux.(3+BNnKEWKJJK\s!;+St>0591>6:2<48;[Zji a|؝5A/ c4t LiVLՃ  '$&%gD"QFzlJrRbB|\\l *2<,48כpuvd۱lЂ:tB{o >$'-!B¨̂ΰl).ϋ
-9-QaC|}|/2t 3`pц&IHKaԪd!`e[3OG'gW7w'˛yr=\]8l{;I%x 'zXFR'wi1"]#llC#cS3s n`XY0Yp8lPe1m K:faanfjldhGP_Uetw0A|ƩѪedp) :T>B7u`AQ: 4_^`BoWzF*$L!tL"V5
-L&TUU.΋|ߨmi]#lX".V'U1VE'ee?&]85k 1n
-HV{|SnUHpKK%-J
-i£
-0Фm 
-*/E|Tz, S`2>g:n0@vn}>cs}so.E{Z>w
-w.BS0 H)+g+w]:J`ܟ(\&-$NTT1S(H&C1j(CPn1^ @Q1 dEK!P3.s""FRǶOhA I;SL|`]һf<͖ޣg9}?h2t_9h3W&>ׇ2Ɂ)SULQ9s̝7O,|rQ⧖<tYڕV?~uyao_|W_ݰqS-moλw~v]?l޳}?C>rϞ|˅ᨷNS"O"zl,yIw;ȝW4 !E0 V!]!Yt+gUY;Xu$klYZVڡ+PH- 6yB|!_z(._Z櫌|P(g =Zr![ƹDuqŵ 淬mR l!jho#{z|=
-qDܷnklF<7K,j%M
-A KPXuXpel5\ſo -kPO'8c8#8 qoc2ó88
-!IF1Ym3Y,OVNi-tw)1SmH %:
-dǍpU^b rAFβr9EJvydQ juM%1>!:qYh'40ҭld,p.gF2%MҜ2K^BDmISy"Y+`LR9$u80EI3+4(2rl"(r#8BP x.npXMvICHcȂAq ` Տv)wcN3g`:ў9S
-eW68!7wH+DYQĄ%%R1n+0EF9p
-9a@J c"7.xYݶiQ^ļKws|Q*Ms2]`%
-7k
-UF 6+^Z&ZZ4
-[ˊo44gACo\a7.C2s~Ήb7=ENd_Q.*A@~EͶtjVPgجu0w6sfXg+4 ZunHM FuE0^Mw~w~ŏyG_.&89 I!44
-Re(U`B mQ
-zyv~9Oclw\'//w`O5kC
-
-7Vʊ+{/Fw۫Eu/ :1+yT &t`lZلaXy-Ó9|!ҁ,t 04@œ~ WuZu:H஝Þw)wl8 71<_hh6&m
-zQdr8",߂QcdP<d(i89TJL\Մ#5ᕎz
-lZJe$xۘAcFFKlaY",F!2& DAuE4p#wjWG aF>FA0|\o,O뭌I-u;o~nEyi;i-7۶}C
-vڲyk ?u@A;1ɂ19O.Nې$qS 1:nQGhf$ sې}I3BY6X;>z݁+OM/Wx2Yp>+01n`3KӚQQ>2}j\Uj:n:kL7 yɇd@i33٬/ =ڵkNW~.2Ķ}?yHoⷉ5_.
-uxtésկx[- "Ql3}pEYD0*yRakL"a4BD0_jLJR Kh\Jܻ[{N*>r6a` Ʈ:RN q
-VoTz8 Fj jwq5KWNxyuƍպNKGbop>d
-9B!_ț4b
-U]j7'\q#Qx&/QA5׃ t `k @ =#=@=
-\w1Y 3'$B 2_;Nza_w |x乒olzKc_:CҡC]CDy0<~:G1w|$g<a1V!igE4DS 3}]eFliP[MM=zG<ۻ7''o7nIv"yI f̀49JeNQ((7zc27n
-Kxjd*<ܪ`M&H+/w7^v$)bFoe@c5
-,Yҡ' ZuK6W&'d;T{؆QO6`5m77y5ZZ-49{_^^Z|? }Bدب+|޽wއ{׷Ư+c11]6i]55j֡+Bip*H.U%MK.QSEP( m$h!Xn #}wΜ93sΙsΩԲBu(432t0f7lj2Y_ʮj?ϏĜq9YX+f,fve>|^MbUG{pzvhq=ҩ4qyG2 '>3۬IiЕLy(>zcGa;hƘUFN~hHV%?4m?ԛX}]qR!2=l_\'pVDf_VNU5;TEt8N(G`,Cqrmf?a4oB߉gK:~cEԐ-ܺ'%! wŸg2lȕWdkTYzP'YBdSR:>*o:Z=f%e7-FlZj6xZiYǮ*Gf]18!)k9<ֹ,& Λ;1?#K+*yy>ɗːH!Dr#RtYdOY{Ÿ_WgK_h})Q|܋ , ~&rO֚W`uLkhMZW|ĽȨh|g_1 (B]w: â;g}b{ 6;1zxi^yo~~1T8a50rqW482D\Ԑrh YY*l (=L\kŵDl ?q&Zvً-% u<uʘ8'?&ʃCasYj*c.N4ujcV(BaQ^H^}xb5w9Gs:0HdU5sߒ}sR'][hBMiJ.uY@}J'y1N 
--$֑(m?қ4"\*t04%ͦ iGyj>ÎQ-GG=J;* 7Ej^+e]KTh>j{Nx}žƱ,
-VkBPlWz,[H'O7ݫo CkKx B;P튆n.?PٶeږbD--@ 0)v
->BNQ<^#p#5 -SzDCJ*T?2J=ͭmiUsi,2^pBqޠs14ƆI|U΍#e%4X !|,#о@#!NU|7=W/d&kQЃ=T2CДn?̪FArVi |CCȶJ7 >pX``O#t+o';q$-q#
-H|kxW;ϝ}ξ76<XH4!dBTZb(j
-jVjVm->CZ̒ٹs
-i%"00qg_#~۸ubn
-<[݇gqN]bXɜ
-[ eܸ"Arp&Y@Vr{4p$Zad*QU]S9+Wohl60cή K.[bWW֬]7~phxƑMha󖭣? ۭ@w3;>
-w]|ⓟO|_~xC_z_yWڡǾ~7o>q[ǿS:~8?O:Og쳿xz~ ,I600XO! G)8籢.U0rG7 ͈icbKi$C8p
-U@_nK|ϼlm^44onf^0ϛ5_6cC];zK
-g
-l'8ESpwIvMY"5QSctTw_hL&ncd`Ħ Ó:7ἢ?Vj/n,Zzز"j<asY*L\MQbҽK:Cb(3JgzKg:Cb'Ex&<3_UWaz1fY ig>RQWӽJt^`}QF%()_
-$ED<r tSA._Sm6fWL2m^&!,0#$kKb+ /qZ1E,v C$=p(xRzV<G)R^-#ILWMUL\]}b4ȋveqйt~NSeYWX֨s{WK'vX
-u^V<$W,Ӑolʧ9
-찫ѰOd+N"H28yV܂ZE*B[i^J82$1R2Es.˟cUAE6ˡ9]v!OD4 CxS 9y(.q9⏗Rkm
-Bnqyz_^d5'##"7:I$ O@C4!E_=ؖκULeu\Pg4c !:z :Uѡ(Av!nաHT`7)Q.͛o
-#$BU9sE | -[yTbʇ*K[W2,t r0nB1ż(va"ي&ͱ+͢fZ9gL:h줟a܉V,cHFoT1*8+s/ v(f_3srX|6Mnuҍ2kՎэ.zanbx@<GqU5Mt!­ j/Rq{E?e1@Hʧ%|Y87&mulK x\z6jU̳4sx*P;;(BэՐ+UNÿȥ6A; KR\B㳸ZYz#|G[ZGZE8z+ߘyܼcwM9mbM{ɓS9, S*ٿ~ yr#7?VLwW]}&X%kr@
-q
-0 g
-/GS0 gs
-15.8993082 0 0 -16.1025677 7632.3847656 6956.671875 cm
-BX /Sh0 sh EX Q
- endstream endobj 891 0 obj <</CS/DeviceGray/I false/K false/S/Transparency/Type/Group>> endobj 892 0 obj <</AntiAlias false/ColorSpace/DeviceGray/Coords[0.0 0.0 0.0 0.0 0.0 1.0]/Domain[0.0 1.0]/Extend[true true]/Function 893 0 R/ShadingType 3>> endobj 893 0 obj <</Bounds[0.210899 0.350209 0.494759 0.604521 0.917524]/Domain[0.0 1.0]/Encode[0.0 1.0 0.0 1.0 0.0 1.0 0.0 1.0 0.0 1.0 0.0 1.0]/FunctionType 3/Functions[894 0 R 894 0 R 894 0 R 894 0 R 895 0 R 896 0 R]>> endobj 894 0 obj <</C0[0.5]/C1[0.5]/Domain[0.0 1.0]/FunctionType 2/N 1.0>> endobj 895 0 obj <</C0[0.5]/C1[0.987469]/Domain[0.0 1.0]/FunctionType 2/N 1.0>> endobj 896 0 obj <</C0[0.987469]/C1[1.0]/Domain[0.0 1.0]/FunctionType 2/N 1.0>> endobj 888 0 obj <</G 897 0 R/S/Luminosity/Type/Mask>> endobj 897 0 obj <</BBox[-32768.0 32767.0 32767.0 -32768.0]/Group 898 0 R/Length 86/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ExtGState<</GS0 744 0 R>>/Shading<</Sh0 892 0 R>>>>/Subtype/Form>>stream
-q
-0 g
-/GS0 gs
-11.9217148 0 0 -12.0797682 7632.2294922 6995.9882813 cm
-BX /Sh0 sh EX Q
- endstream endobj 898 0 obj <</CS/DeviceGray/I false/K false/S/Transparency/Type/Group>> endobj 887 0 obj <</G 899 0 R/S/Luminosity/Type/Mask>> endobj 899 0 obj <</BBox[-32768.0 32767.0 32767.0 -32768.0]/Group 900 0 R/Length 88/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ExtGState<</GS0 744 0 R>>/Shading<</Sh0 892 0 R>>>>/Subtype/Form>>stream
-q
-0 g
-/GS0 gs
-225.9361572 0 0 -225.9361572 7629.4453125 7389.2958984 cm
-BX /Sh0 sh EX Q
- endstream endobj 900 0 obj <</CS/DeviceGray/I false/K false/S/Transparency/Type/Group>> endobj 886 0 obj <</G 901 0 R/S/Luminosity/Type/Mask>> endobj 901 0 obj <</BBox[-32768.0 32767.0 32767.0 -32768.0]/Group 902 0 R/Length 84/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ExtGState<</GS0 744 0 R>>/Shading<</Sh0 892 0 R>>>>/Subtype/Form>>stream
-q
-0 g
-/GS0 gs
-7.9551892 0 0 -8.0455885 7632.2294922 7026.9384766 cm
-BX /Sh0 sh EX Q
- endstream endobj 902 0 obj <</CS/DeviceGray/I false/K false/S/Transparency/Type/Group>> endobj 885 0 obj <</G 903 0 R/S/Luminosity/Type/Mask>> endobj 903 0 obj <</BBox[-32768.0 32767.0 32767.0 -32768.0]/Group 904 0 R/Length 86/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ExtGState<</GS0 744 0 R>>/Shading<</Sh0 892 0 R>>>>/Subtype/Form>>stream
-q
-0 g
-/GS0 gs
-225.9359131 0 0 -225.9359131 6749.46875 7454.5385742 cm
-BX /Sh0 sh EX Q
- endstream endobj 904 0 obj <</CS/DeviceGray/I false/K false/S/Transparency/Type/Group>> endobj 734 0 obj <</LastModified(D:20140918115258+02'00')/Private 905 0 R>> endobj 905 0 obj <</AIMetaData 906 0 R/AIPrivateData1 907 0 R/AIPrivateData2 908 0 R/AIPrivateData3 909 0 R/AIPrivateData4 910 0 R/AIPrivateData5 911 0 R/ContainerVersion 11/CreatorVersion 16/NumBlock 5/RoundtripStreamType 1/RoundtripVersion 16>> endobj 906 0 obj <</Length 960>>stream
-%!PS-Adobe-3.0 %%Creator: Adobe Illustrator(R) 16.0 %%AI8_CreatorVersion: 16.0.0 %%For: (Coraline Lafon) () %%Title: (logotalerv2.ai) %%CreationDate: 18/09/2014 11:52 %%Canvassize: 16383 %%BoundingBox: 224 -1014 1618 26 %%HiResBoundingBox: 224.5146 -1013.7627 1617.3057 26 %%DocumentProcessColors: Cyan Magenta Yellow Black %AI5_FileFormat 12.0 %AI12_BuildNumber: 682 %AI3_ColorUsage: Color %AI7_ImageSettings: 0 %%RGBProcessColor: 0 0 0 ([Repérage]) %AI3_Cropmarks: 0 -1080 1920 0 %AI3_TemplateBox: 960.5 -540.5 960.5 -540.5 %AI3_TileBox: 582 -828 1316 -252 %AI3_DocumentPreview: None %AI5_ArtSize: 14400 14400 %AI5_RulerUnits: 6 %AI9_ColorModel: 1 %AI5_ArtFlags: 0 0 0 1 0 0 1 0 0 %AI5_TargetResolution: 800 %AI5_NumLayers: 1 %AI9_OpenToView: -307 125 0.5 1389 670 18 0 0 163 161 0 0 0 1 1 1 1 1 1 0 %AI5_OpenViewLayers: 7 %%PageOrigin:524 -780 %AI7_GridSettings: 72 8 72 8 1 0 0.8 0.8 0.8 0.9 0.9 0.9 %AI9_Flatten: 1 %AI12_CMSettings: 00.MS %%EndComments endstream endobj 907 0 obj <</Length 10404>>stream
-%%BoundingBox: 224 -1014 1618 26 %%HiResBoundingBox: 224.5146 -1013.7627 1617.3057 26 %AI7_Thumbnail: 128 96 8 %%BeginData: 10254 Hex Bytes %0000330000660000990000CC0033000033330033660033990033CC0033FF %0066000066330066660066990066CC0066FF009900009933009966009999 %0099CC0099FF00CC0000CC3300CC6600CC9900CCCC00CCFF00FF3300FF66 %00FF9900FFCC3300003300333300663300993300CC3300FF333300333333 %3333663333993333CC3333FF3366003366333366663366993366CC3366FF %3399003399333399663399993399CC3399FF33CC0033CC3333CC6633CC99 %33CCCC33CCFF33FF0033FF3333FF6633FF9933FFCC33FFFF660000660033 %6600666600996600CC6600FF6633006633336633666633996633CC6633FF %6666006666336666666666996666CC6666FF669900669933669966669999 %6699CC6699FF66CC0066CC3366CC6666CC9966CCCC66CCFF66FF0066FF33 %66FF6666FF9966FFCC66FFFF9900009900339900669900999900CC9900FF %9933009933339933669933999933CC9933FF996600996633996666996699 %9966CC9966FF9999009999339999669999999999CC9999FF99CC0099CC33 %99CC6699CC9999CCCC99CCFF99FF0099FF3399FF6699FF9999FFCC99FFFF %CC0000CC0033CC0066CC0099CC00CCCC00FFCC3300CC3333CC3366CC3399 %CC33CCCC33FFCC6600CC6633CC6666CC6699CC66CCCC66FFCC9900CC9933 %CC9966CC9999CC99CCCC99FFCCCC00CCCC33CCCC66CCCC99CCCCCCCCCCFF %CCFF00CCFF33CCFF66CCFF99CCFFCCCCFFFFFF0033FF0066FF0099FF00CC %FF3300FF3333FF3366FF3399FF33CCFF33FFFF6600FF6633FF6666FF6699 %FF66CCFF66FFFF9900FF9933FF9966FF9999FF99CCFF99FFFFCC00FFCC33 %FFCC66FFCC99FFCCCCFFCCFFFFFF33FFFF66FFFF99FFFFCC110000001100 %000011111111220000002200000022222222440000004400000044444444 %550000005500000055555555770000007700000077777777880000008800 %000088888888AA000000AA000000AAAAAAAABB000000BB000000BBBBBBBB %DD000000DD000000DDDDDDDDEE000000EE000000EEEEEEEE0000000000FF %00FF0000FFFFFF0000FF00FFFFFF00FFFFFF %524C45FDFCFFFDFCFFFDFCFFFDA4FFA8FFA8FFA8FD77FFA87D5227272752 %2752527D7DFD71FFA85227F826F82752277D27527DF8F8F8527DFD6CFFA8 %52F82727527DA87DA8277D52A87D7D7D52F827277DFD69FF5227F8527DA8 %7D7D527D5252527D52FD057DF827F8277DFD66FF27F8277D7D7D52527DA8 %A8FFCAFFFD04A8527D27522727F8277DFD64FF26F852A87D5252A7A8FD05 %FFCFFD05FFA87D27522727F82652FD41FFA8FFA8FD1EFFF8277DA87D7DA8 %FD11FF52522727262752FD3BFFA87D5252FD05275252A8A8FD18FFF8277D %A85252A8FFA8FFA8FFCFFFA8FFA8FFA8FFFFFFA8FFFFFF7D522727F8F852 %FD37FF7D52F827F8F8F827F827F827F8F8F82727A8FD15FF525252A8527D %FFFFA8512752A8FD04FF7D76FFFFA8A8FFCFFFFFFFA852275227277DFD34 %FFA85227F8FD042752275227522752FD0427F8527DFD12FF7DF87DA85252 %CAFFFFCF522752FFA8527DFF7D52CF7DF852FF5227A8CFFFA8522727F827 %A8FD32FF7CF827F82727522752527D527D527D525227522727F82751FD10 %FFA827F8525252A8FD04FFA827A8FFA8F852A87D52FF7D2752FF527DA8FF %FFFF7D522727F852FD30FFA852F8272752275252A8A8FFCFFFFFFFA8FFA8 %7D5252FD0527A8FD0EFF7DF87D5252A8FFA8FFFFFF7D527DFF7D5252CA7D %7DA8FF527DA87D7DFFFFFFA8FF52272727F8A8FD2EFFA827F8FD04277DA8 %FD05FFA8FFCFFFCFFFFFA87D7DFD0427F87DFD0DFF527C7D7D7DFD05FFA8 %FFA8A8A8FFA8FFA8FFA8CFA8FFA8FFCFFFA8FFA8FFFFFF2752272752FD2D %FFA827F827275252FD11FFA87D52522727F8A8FD0BFF7D277DA852FD04FF %52FD07F827F8F8F827F827F827FD05F827A8FFFF7D2727F8277DFD2BFFA8 %27F82727527DFD05FFA8FFFFFFA8FFFFFFA8FFFFFFA8FFFFA852522727F8 %A8FD0AFF527DA8527DFD04FF7D522727275227522727F8F8F82727522752 %2751272727A8FFFFA8522727F87DFD2BFF52F82727527DFD16FFA8525227 %27F8FD0AFFF852A8527DFFA8FFFF7D2752272727512752FD05F8FD042752 %2727277DA8FFA8FF52FD0427FD2AFF7DF82727527DFFA8FFCFFFA8FFCFFF %A8FFCFFFA8FFCFFFA8FFCFFFA8FFFFA8525227F827FD08FF7D27527D52FD %05FF7D272727F8FD0527F827F827F827F8272727F82752A8FFFFFFA82752 %2727A8FD29FFF82727527DFD1AFFA8525227277DFD07FF7DF87D527DFFFF %A8FFCFFFFD08A827F82727F87DFD06A8A7A8A8FFA8FFA8272727F87DFD28 %FF5226272752FFFFFFCFFD18FF7D5227F827FD07FF52277D527DFD0EFF7D %F8272727A7FD0DFF275227277DFD27FFA827F82752A8FD04FFA8FFCFFFA8 %FFA8FFA8FFCFFFA8FFA8FFA8FFCFFFA8FFFFFFA87D5227F8A8FD06FF7D52 %A8527DFFFFCFFFA8FFCFFFA8FFCFFFA8FF5227272726A8A8FFCFFFA8FFCF %FFA8FFCFFFA8522727F87DFD27FF7DF827277DFFFFA8FF52FD15F852FFCF %FF7D52272627FD06FF52A87D527DFD0EFF7D275227277DFD0DFF52522727 %52FD27FF27272752A8FD04FFA852FD047DA17DA827F8F8F852A8FD067D52 %A8FD04FF52522727A8FD05FF52272727A8FD04FFA8FFFFFFA8FFFFFFA8FF %5227525227A8CFFFFFFFA8FFFFFFA8FFFFFFA8522727F852FD26FFA827F8 %2752FFFFFFA8FF7D52527D5252527D5227F827F827527D5252527D527DCF %FFFFFFCF7D2727F87DFD05FF52F82752A8FD0EFF7D277D5227A7FD0DFF27 %52272752FD26FF7DF827277DFD05FFA8FD07527D27F8F82727FD0852FD05 %FFA752272752FD05FF7DF827277DFFFFA8FFCFFFA8FFCFFFA8FFCFFF5252 %7D5227A8FFFFA8FFCFFFA8FFCFFFA8FFA8272727F87DA8FD25FF52F8F852 %7DFFA8FFCFFD0AFF7DF827F87DFD08FFCFFFA8FFFFA85252F827FD05FF7D %2727527DFD0EFF7D52A87D52A7FD0CFFA8277D52277DFD26FF52F82752A8 %FD0EFF5227272752FD0DFFA87D272727FD05FFA8F8272752CFFFA8FFFFFF %A8FFFFFFA8FFFFFF52527D7D27A8FFFFA8FFFFFFA8FFFFFFA8FF7D27A87D %F87DFD26FF27272752A8FFA8FFFFFFA8FFFFFFA8FD04FF7DF827F87DFFFF %A8FFFFFFA8FFFFFFA8FFFFFF52522727FD06FF27F82727A8FD0DFF7D52A8 %7D277DFD0CFF5252A82727A8FD26FF52F82752FD0FFF5227522752FD0EFF %7D272727FD06FF52F8272752FFCFFFA8FFCFFFA8FFCFFFA8FFFD045227A8 %A8FFCFFFA8FFCFFFA8FFFFA8277D272727FD27FF27272752A8FFCFFFA8FF %CFFFA8FFCFFFA8FFFF7C2752277DFFFFCFFFA8FFCFFFA8FFCFFFA8FF5252 %F827FD06FFA8F8272752A8FD0CFF7D277D52277DFD0BFF5252A852F87DFD %27FF52F82752FD0FFFFD0552FD0EFF7D272727FD07FF52F827277DFFFFA8 %FFFFFFA8FFFFFFA8FF5227525227A8CFFFFFFFA8FFFFFFA8FFA8277D7DF8 %27A8FD27FF52272752A7FFFFFFA8FFFFFFA8FFFFFFA8FFFF7D277D527DFD %04FFA8FFFFFFA8FFFFFFCFFF5252F827FD07FF7DFD0427A8FD0BFF7D2752 %2727A7FD0AFF5252A8272752FD28FF7DF82727A8FD0EFF52527D7D7CFD0D %FFA87D272752FD08FF27F8272727FFFFFFA8FFCFFFA8FFCFFF52272727F8 %A8FFFFA8FFCFFFA8FFFF7DF87D7D2727A8FD28FF7DF8F82752FFA8FFCFFF %A8FFCFFFA8FFCFFFFF7D52A8527DFFFFA8FFCFFFA8FFCFFFA8FFFFA82727 %F87DFD08FFA82727275252FD0AFF7DF827F827A8FD08FFA8527DA852F87D %FD2AFF27272752A8FD0DFF52527D7D7DFD0DFF7D522727A8FD09FF7DF827 %272752FD05FFA8FFFFFF52FD04F8A8FFFFA8FD04FF7D52A87D7DF852A8FD %2AFF52F82727A8FD04FFA8FFFFFFA8FD04FF7D277D277DFFFFA8FFFFFFA8 %FFFFFFA8FFA852272727FD0BFF7DF827275252A8FD07FF7DF827F8277DFD %06FF5227525252F852A8FD2BFF7D27275252FD0DFFFD0552FD0CFFA85227 %F87DFD0BFFA852F8FD04277DA8FFFFFFA8FF52FD04F8A8CAFFFFFF7D5227 %7D5227F8277DFD2DFF272627527DFFA8FFCFFFA8FFCFFFA8FFFF76275227 %7DFFFFCFFFA8FFCFFFA8FFFFA85252F827A8FD0DFF7DF827275227527DCF %FFFFFF7DF827F827A8FFA8A8272752A87D5227527DFD2EFFA8F827277CA8 %FD0BFF5227522752FD0BFF7D52272752FD0FFF7DF827F8FD04275252A852 %FD04F852525227527DA87D27F8527DFD30FF52F827277DCFFFFFFFA8FFFF %FFA8FFFF7CF852F87CFD04FFA8FFFFFFCFFF7D52272727FD11FFA82727F8 %2727522727277D527D272727FD057D2727277DA8FD31FFA827F827527DFD %0AFF52F8272752FD09FF7D7D2727F8A8FD12FFA85227F827F82727277D7D %7DA87D7D527D52FD04277DA8FD33FF7DF8F827277DA8FFCFFFA8FFCFFFFF %7DF827F87DFFFFA8FFCFFFCFFF7D522727F87DFD15FFA87DFD0427F87D52 %7C525252FD0427527DFD37FF7D272752277DA8FD07FF52F8F8F852FD07FF %7D522751F852FD18FFA87D7D52522752FD0527527DA8A8FD39FF5227F827 %27527DFD06FF7DF8F8F87DFFFFCFFFFFA852522727F852FD1DFFFD07A8FD %3FFF7D27F827275252A8A8FFFFFF52F8F8F852FFFFFFA87D52522727F87D %FD65FF7D27F8272752275252A8A852F8F8F852A87D5252275227F8F87DFD %68FF7DFD0527FD04527DFD06522727F82752FD6CFF5227F8F8F8FD042752 %FD0427F8F82652A8FD6FFFA852522727F827F8FD0427527DFD1CFFA8A8A8 %FFA8A8A8FFA8A8A8FFA8A8A8FFA8A8A8FFA8A8A8FFA8FFA8FFA8FD3DFF7D %A87D7D7DA8A8FD1EFFA8FD0FFFA8FD09FF52FFFFFFA8FD56FFA8FD19FF7D %2727A8FD06FFA827A8FD58FFA8272752FD08FFA8FD0EFFA8277DFD08FF27 %FFFFFFA8FD55FF7DA8FF2752FD07FFA8A8FFFFA8A8FFA8A8A8FFA8FFA8FF %FF7DA8FFA8FFFFA8FFFFA827A8FFA8FD0BFFA8FD4AFFA8FFFFFFF8FFFFFF %7DA8FFFFA8FFFF7D7D7DA852A8A8A852527D7DFF52FF27FD057D52FF27FF %FFFFA8FD09FF7DFD4BFFA8A8FFFF527DFFFF7DA8FD04FF7D52FFFF5252FF %7D7D27A8FF7DA87D7D27FFA87DFF7DF8A827FFFFA8FFFFA8A8FD05FFA87D %FD4BFFA8FFFFFF5252FD06FFA8FF7D7DFFFF7D52A8A8A852FFFF7DFF7DA8 %27FF7DFFFFFFF8A827FFFFFFA8FF7DFD53FFA8A8FFFF7D52FF52A8A8FD04 %FF7D52FFFF7D27FFFFFFF8FFFF7DA87D7D27FF7D7DFF7DF8A827FFFFA8FF %FF7DA87D527DA8A87DA8A8FD4AFFA8FFFFFF527D52A8FF7DA8FFA8FFFF7D %7D7DA87D7D7DA87DA8FF7DA852FF52FFFF7D7D7D52A852A8FFFFA8FF52A8 %52FFFFFF27FFA87DFD4AFFA8A8FFFF277D527D7D52FD0BFFA8FD05FFA8FD %06FFA8FD04FFA8FD04FF52A8FD047D527D7D7DFD4AFF7DFFFFA827FF27FD %05FFA8FFA8FFA8FFA8FFA8FFA8FFA8FFA8FFA8FFA8FFA8FFA8FFA8FFA8FF %A8FFFFFF52FFFFFFA85252FD4DFF7D277DF8A8FF527DFF7DFD07FFA8FFFF %FFA8FFFFFFA8A8A8FFA8FFFFFFA8FFFFFFA8FD06FF52A8FFA87D52527DA8 %A8FD33FFA8A8FD15FFA87D52FD04FF7D7DFFFFFFA8A8FFFFA8FFFFFFA8FF %FFFFA8FFFFFFA8FFFFFFA8FFFFFFA8FFFFFF7DA8FFFFA8FFA87D52FFFF7D %7DFD35FF7DFD21FF5227FD0B7DA8FFFFA852FD0A7D5227FD3FFFA87DA8FD %20FFA8A8FD0CFFA8FFA8FD0BFFA8A8FD3FFF7D7DFD30FFA8FD4DFF7DFD80 %FFA8FD14FFA8FFA8FFA8FFA8FFA8FFA8FFA8FFA8FFA8FFA8FFA8FFA8FFA8 %FFA8FFA8FFA8FFA8FFA8FFA8FFA8FFA8FFA8FFA8FFA8FFA8FFA8FFA8FFA8 %FFA8FD31FF7D7D7DFD13FF52F8272727F8272727F8272727F8272727F827 %2727F8272727F8272727F8272727F8272727F8272727F8272727F8272727 %F8272727F8272727F8A8FD2EFFFD04A8FD13FF27FD39F87DFD2FFF7DA8A8 %FD13FF52FD0FF827F8272727F8272727F8272727F827F827F8272727F827 %2727F8272727FD0DF8A8FD45FF27FD0EF827F8F8F827F8F8F827F8F8F827 %F8F8F827F8F8F827FD04F82727F827FD0EF87DFD45FF52FD1DF8525227FD %07F87D52F8F827FD0DF8A8FD45FF27F8F8527D52FD09F827FD0DF827A8FF %52FD07F8527DFD10F8A8FD45FF52F8277D7DA8A8FD07F8272727F8F8F827 %FD09F85252FD08F87D52F8F827FD0DF8A8FD45FF27F8F827F8F8A852F8F8 %F827F8F8F827F8275252F8275227F827525227F82752277D272727522727 %527DFD0DF827F8F8A8FD45FF52F82727F8F852A8F8F87D27F8F827F8277D %2727527D52F8527DFF275227277DA82727525227FF527D52F8F827FD09F8 %7D27F8F8A8FD45FF27F8F827F8F8F8A8FD07F827F8A8F8F8F8A82752527D %52F8F852F87D7DF8F87DF8F87D7D527DFD04F82752FD0AF87DFD45FF52F8 %2727F8F827A827F827F8F8F827F827A827F8F8A827F8F8527DF82752277D %A8F82752F8F8A87D7D52F8F827F82727F8F82727F8F827F8F8F8A8FD45FF %27F8F852F8F8F8A8277DF852F8F8F827F8A82727277D5227277D7DF82752 %277DA827F87D2727A87D527DFD04F82752277D5227277DF852F8F87DFD45 %FF52F82727F8F8277D7D52277D27FD04F827525227F8525227F827F82727 %522752F8F8F852522727275227F827F8FD045227F87D7D277D27F8A8FD45 %FF27F8F827F8F87D52527D2727F8F8F827FD1EF82752F852527D7D7D2727 %F8F8A8FD45FF52F82752F827FFF87D52F8F827F8F8F8272727F8272727F8 %272727F8272727F8272727F8272727F8272727F827F8527DF8F8F852A852 %F8F827F8A8FD45FF27F8F87DA8A827F8F87D5252F8F8F827FD0DF827FD0D %F827F8F82752F8527D7D277D5252F8F8A8FD45FF52F8F8F827FD05F827F8 %F8F827A8A8527D527D527D527D527D7D27F8F8277D527D527D527D527D52 %7DA8A8F8F8F8272727F8F8F827F8F8F8A8FD45FF27FD0EF87D52FD0A2752 %F8F8F8FD0C277D52FD0DF87DFD45FF52FD1BF827F827FD1BF8A8FD45FF27 %FD39F87DFD45FF27FD39F8A8FD45FFFD3A7DA8FD44FFFF %%EndData endstream endobj 908 0 obj <</Length 65536>>stream
-%AI12_CompressedDataxr$7 m#ͶH^۶fdl$+Uul혌dJ%ɬjww!MYW8s_q3m.o~WW>arc?Hxy{;~<ûޝ_]\lޜrŗ/.ǫ۟nϯ.b/8'q:c~,v8Ǐ?G~ywync|ehF_.pq ;H&trwwo/>~^}f?/vquun9^?/.>B}݇O/w^6ᇳ˫ Xpt%f֟>|`j__C0
-zW.߿?\ yݧ /a{0||3)DI:<
-h9&twD@Tf`x1s:l
-G[:r\
-l0 qO~`
-};oܩ;q[w&]pYggԞح=dM6dY G֨b(|\<Xg$1{JdE2ELK䖨8ycDSZ3sEAANv[QEB9KrgB9$ f!N аPqB2)=DZ255E@Q
-:r "LDÉ8{Dr%Tuq2`,NF$["2c |04X"3XZ'Ds
-(I>BD3
-;*,14R̠'LO;`́qʥE@%(;ju <PBB[*߱F-eB]?_m8QSle1Y-7si6Ɗ`f=ٸz,ᩦUkYv@a&'>, 2˜ KԊhwUt"[3* :G&bis8s0=&?*6"ġIz5-}qnA5ױG7 = ڝݲiy<hgesVюݟyּUpw4N6k.Ӳݮrd[*iq+vw;QirDڔY<7*F2 Ƿ-6 f^o ކ'Q5T쩛]W$R(Ϋs:4!J6DYl]TՖH۩"Zz*= -b?kKD^/<-v o6I!7{%.TpJlCvo[ncc0s|{℞LKl4qMzC-AGVMqx%%v1n뒶qDףBv%e{t2SdJ6Ua-mokwf(o[5;#FCPx|hBCvWROِaX;<KbSJyҦ })նmL"7ښٟP6d-fyņa㨡 =GOrsul:zζ#w<"zTuTix1U_Hgo$u}
-]g>a;ׇjqua3>P_vSOZަ}}ہ_K:?uIlog늙nrSS#s凋%ebåƑ)|l׶|Z^[wS-09U
-qgq޹jJ J]~JISt5' <1Dɂ5cdb!ؑyĺ &O1)F4
-+~r1YѲjy\Ee\xH#%պe].Nv8-δ
- ,1Jvf]b"CIsaBEVlhs,;Bౄ6F]6ҭ; G JG#]
-C
-֐=뎯%Tb>c[NM~frĝyyxr'(7cgڱe
-ۮ~3=[~1vyV}S1K0\K]_TqQ|f9t4=)69=Òg_`~USY51#iD!T9WL 7О#\c]33
-/ 2 4ܿ-YM;Z`|P 2کpi) 蛆{W>FŇj^tpsrOz;=l|ZZ$C/:t9Z\ iXE^{p٧Uz
-">c(p,/D8 o9A Zp;ht}ςu:l*! Бf>-VqSQw33w?ѓ%!4XZo,M,m3)s0Q ϹV'F)%fR/^}dPR
- :.h %7"bAFLԴVjׇ 2$,Cd,K8BJIy]mO*ʴ]i=#RZֵ4I,/_.YVdP4WK)Q$,ԉJ J\^*he>=v@V b.,s{r K{9⠘^οY1QvL69.V,/b Tpn1a{0H
-bPѲ EaŽ֬}a[o mLc
-MhF#ΘaۦN28㪘:5h7G:S9 0V cwzLg'F-P{`rK,^i-UaJe")/{*ǖrlKvSo"CWdۺ1;Λ(s鋢Lg֖Ly}+wZV0/
-׫Zȉ
-f*w垏j?밽922kMv-T#{`'L=ªE״ZjPpM\Kc9 ZEX0ڲ$Dځl%Yj@9Iw$/(zaԢȯ'vSb( u ^lwm~ f’YNUۑ.;;H'v#t}Q개Ta2TPF/߽Z c$nt]sO@9Աgc_M17V?ʂ
-D~6r+H5|%khy'v{04h *u΁
- Pkxb5{POUGK]OCRegہ}+H1j|a &lCPIaVzhӲay, v
-d󛪏+J^TYj^;(>^
->(jutFGTA`s/o0>ƨst1)kOv âg.&ОsugSuο:rEڋwϒ-8u&A>LL|vqY{ e|SA`U~:WjJSёDvQGT\vrH=PRrLG%!?: jN03ʁ<VɱC꩞1OeIG;4,0L'c9e#0c=Q61qYG:wX!ʑݓP7F էAWl)ؤw Zdp,̃ ^M1$
-P"7&z}dL:$Bxch W>[q݉t,WЫ/;%y߾CqZz}RJ3 ֒
-HرS
-5F8ZU8i|uLi.ˎ FꊥEД-Us{y[h)*iXg;Ю:n< Zuuh"/
-:w}\{/:'WIcQV(z0
-RNFQ<PRq=Oi2#R۷GG ׋JXMձ)mq{F2ONqL^ }N^Ob5 u|q4ll)7"P*Q2h
--^L܁)>øa}iWF)n时d| fy <F~藎P
-~滻˛˛g? |_6_]___|r(6mɚ1t`M;02W>/jo~7?}Ճ6oЛjncs /ᰛ۫G_ :~8}wy{˫p L[/H<=`c|
-p'L#D2<4Mfi"Pq'-ƺB#q&d LL}DMj`ByDǒ<"79
-
-fTIE,n ȶɡAY6ʓ
-LK
-H bQ
-^EICD0ٍ
-F% Lv lD6CcР"A1,pWB̈́4 `EHlQfAs<4*3&@UrQ#܄aУ-T9򏃎ދőXMG` 5 ^{KO1Bܠ>".A_Rbk
-ΆGE
-/|8q@ l45QwBT& 48S I E5_p6dF@p!Ĉ
-,>m$ OF  pVP ڡ-PmhF!c0Xd6lxbVX
-iRY!
-|nUiVMVm(X ELm(mu2rHLBVq+헀HCUhRGP4DXXӄ>TJxt%a5Rx T¹S#':nT[Bd(A:BJ ԥ-20@SԩNyt!}cSCERuh
-j LF60#%O!KE40
-J%1JP
->]sL
-D1J&$ _"R菂#RkQ
-!EyH*u
-aPGw޶Q(hH BA2RPbP2EEن
-B_'3s~3!JrL|-&*dJ ;H #6c 2Ɔ2 ml\˻Lx*B}K#ALO
-p4VJJ7&8|#hIiѡtFs
-otNΒotp f4߈T)F* P7:bp_o6KHoП}oDC1ohd4ΉM8z4@,pqFHaL"iN8:PT@Quq9k/YqY`\&<kڄ#>2PO$]@uqtfMȩw80gf6G&4QɬԔ\rt7!{HSqI9n2ȳi8 ("GjBi2r4S
-snեa68:qƈf~#Vqnx ՜qKmэ0_#%s(uUkm\,@79^q`(ò%u,bՌXFi'M9r/6=>`g[(u;bev
-M&3#IkbFcᭉG1$%hA@ I<
-ML%>2Q(J 3\%Qm$'Kd+9t%l[6Z K\lkk}f
-◌%d81%gi1%H%q$XmҢ%!92Ҵ%t$VD-P5-
-6iK&mi& KQWJk%aWѴ% -=V`JgW'GoSڲ }iڲ4#}F }iڲD4m4mY5mY^l^,A/M[-눗f-KK%ޥY&ܥY*N4kYǺ4iYB],.MZց.Y8,KJsMKrMs%%9&9ҜeoiβoIʲ4g4gYb[,-Y6-Y,K\KsMXK%IՒeҤeiiҲ$i4iYY,,MZ,IZ,IZ.Y,,ZPf-Hf-K K%YEssKҖmKҖs
-^_e
-6y]l+mBIr~j!y[ȵ'1'Ҥ0*T3 pbDɊhd3 |Hp<Hba$lI؂ m LzB!HYE?54Я)x[0nE}4)Lzor 3p׿]#:yaCJ" &!X3XL\'rj?oG$ ,AasLơާe6ElӤ
-a܊P1@nb7ܳAG\C'<9%X̄D<LjA,oh΢B>T-+Θ
-[4B pE >0V^>(_]k- Ԃt6Y$W""+CIaD3f3= RBlPJmP(|lPiaܧ+nB-'jkO
-0ckɰ *0\zETQi%B60DZIfO-<g3Oopecl)PA+m
-6qs|(DN[ӲFcF@qN\#
-8A@Z@=,V:8pA > 
-w|etյMlZWMoEx%ߊ| "f,DM#c̔ムo̔rf1fV(ݤ*vvT_{o"V
-kjJiH`j1JciY
-{6E4~͍,E@V֪Elߪ kaɵYvpS|Gߊgi~%I5ib ~m
-%ME1<57Q'R*+Ԏ,bWQ`Wqq/rS(*qf|.s8t|9>i,2;wsčuG{\z'9մm1覴dٮ,ey9̲]/&҈{@LOd,]/FF}T_z\6bF|L4:ϫ2Uf$4w^ xn-
-+p=Dzp):[ispRgB\|&CvvpphyC/0l턋yR,o˯ LΧ=n*s
-Q{ >kPSYͶ#n[
-
-,m$5,ϓ׬uf0DFjQONE\=;q\tnF_rc5 HZq9D -ȉ—e6/aZt/(Dbܬ"!Ȭ=T@{ubOv$nԅ]m5zk rKXF=a'Mzgu \Nzz{+|$n^Sl
-Ipcqi{xkZ~J ֳ ή\߫ͬwzċ‘ liԣfCWT$֌xGs@ 4nd̊m:n()U qdlx
-ϯYS;5 `x X>nȲ}Usxhģ@<I7MTIHmPO~'tJ3x9? 7o:65tV/Vòoe5xx^۴nj\FCx%R)v:D
-"-{-HC!RX):DJ"bH^KCC!Ri9k44u;Dk"M}"'ƞɻ[X%#WZvBG=Б#C{m#WN`!ksv#F{m#ZEءS)t:tZ/:whuNCԡS)vo_5tkH^[H}ii)w;tZ'`cGBO.Q"1w,HNSؼg;Xk^'`cG0Ŏ;lzήC&סr} 5,CСr} #L{m#`tJ:bNCx#`kXrNCx#`SGbG.Ta F_O-GGqE7-[i7I{R=)tQ4u4{Oʝ'-G&$>“׭R? ל4XO˅L8g4iUGiB f;M3j7t"[uEk{^dǕoay {c5܇=:i r6ˈ_jk4=F:L:\w݋l5efǜ^|zYVu=V#SXgjkV4=쩹?:;ӋUb 5+_scA/ ܿg ?f*bWܿ),}ָ=7&
-S;AWc]xQ̓*\ɴΡTG3!~H<$vI^sǓnpWahzC&AuȲ+:"\2"CߡCu3zR\>GixCF)v+;Jbb@"yC!F-v3{Jbb@Gª6E]:>o%۪s\A+W=){O'-G\Kyc{]SksN1W_J/
-ſ<Q:#pHU<D-M35{<`4*R\mqąC/S^irHfQi20d0e{[o6jƢ0{@6
-_\jm=!8OolV|m[_PǞٵ<y dRyt͘zr~q 쳄~Ю`%*^-
-ܤ̔+⢏+<-__t ݃kghT>ڇz]uզ!Cܹ)!NXAj1j/;'>@ezܫ#^l o:LNUkNP ޯFe%˹,ͺY i/m;]`jxh/fMe6n_AA̹%f
-O<&vSnsm;X͙ڦg M'BSۡ<64{}V ._ n6N.O2cr"O5oSy:f䚆MG3~ł~>bZ5KztڟͶn퉍Gc|(t/!`a1dڦ -ܲOxmF-;JZvY^gP4qTp
-Yt=S89Y`e)Ə`]%aߎ衏ٵuȳ?lZrɰVPD[6Pl$ffZMAW
-vŵYbEmfe'Dq3}."/,:U/o>޼>W96
-sRڳǖ}
-UҘXasDG&k,9G66O۳}
-2}*n9}ZHYU(
-ZTC{fG 1Q\wt٧_+$96bWyZ֭
-NȺa! }Z]\YZQ:ɥX<qAfc3CbϮy~f
-FK
-^ϭsVt,Z?q;a3:WAKayIcz_ٟE%=s葵4 [{vK/:I kdS {I oK/)W~ /D޲y
-}eآW%1t{I.ZIOIgL|wBxm_C6槯f8[0|ݧ?8_|sײ}/K{c? ;XUnܤ0U2@<1؀-o`zSZ]78y hA4J"rP%qS#<nGzN:#QPͿR`|/8~9㣷o?]~{? Yb
-GN!'ȉ= = } =rb9C
-i/r&.%iZ#("-rH`}$XҌ3o얭$C)"GXH`-pU")E_w5jH
-B[UF]@FN\ŒW@ 5r\Fז W֍3r2y4Ox ș*p"YTO$ٱzD5@Aj`ԫ-UHvFFGUGenSq\\IZa)HVlv[j3?abhvtۃR_Kc
-IOK87gdM  ?|wW
-)Ƚ߻,<I_&|33AbH!
-ЧLSa,H
-Dd
->nY4
-D+
-NҘ@,8*xwʬp3r "_ڲ5F54f|gxif%aakhN9Lxoa *Ef8#ve ~U+[g_7'.l?+d}Xvކl:TvcGeNacxH
-󬄻ҙBvX; =}-͘!f#6V)<쥑,4y`0E fqA`#ƞzesD
-
-YH$E%5xp
-45@I
-2
-6% Z*Q(<
- rOU@Ţ|)^+k
-74UT gѤ(/"jp#,GaZx~LBwhmYD
-'tԓ9eXA*󢚠])</&~*"jX1psjΓRq$aǃ
-ABH0;)9iz7j,}>BPlݙџiM~OyBZ!֒6KFlL,3&4H AΩ$$,~Ty-]`ɩ$?ZnA)()V|ȖpRqL23rx$Rب"e2^xJ<
-\T/fkhd1JsfCv |p,)p$Q!Ҕ=. jX5줂j1ɫƮQ+T$;_M\ȑ &v'^
-k uh(stvDy"tg Ohi J:. D
-RR^<h7txF,$Rd;S-ńwV>Mqo*0<HT!kRW A c Ƌ
-
-s/2FSb"ҴY`? (06)wDz}:H' fUy
-ɩKJWpɟA Msiàq2%P?Y`<7F1w { (iN2eZP%,sF8vRUOr|Ip)] :%5Ʊ ;MQw&-EPޕűQ"qVs?&H]5F1s}ɒ֩U֩,2*nд0;`)X%PVT3UFTX(yմS&_faJ00
-K
-,I#pq
-,@@$Af2d&{W;>#VR8
-؉-W*MfLuYP){1CoMm V߰+XcH<"C,qHR@F
-z ղ+Xs}8|{q8 KhlrtP)J]5iHAPj-T DVl.S-'F1!8+H 4ic@0v;nhZpY۳A7tѱ
-Zc
-QLB(
-o9=;$y\?/(󒴨лb|6wnt'sž|bu0㯤w
-YX% b5*\`0/tTd\ԣ$o7"
-$*B;(q-Bn޻\ QJ,",&c!`ֈ,01-B3UrK|,d1 Y bƀIe`hS/)\RY7j#x
-K&]0Bs'Pߺz"S ^{nXӃW=~%e#J%AT5^lZڴF{ >ElZ=FAEAC!dޢۆ*4Ch(%1/xW&F@Ћ3co1越Yu1d OtdS1hc"i~28yAkY (ڍL).S~o~(I7{%̫m%`Q7_yߓ-Wޘd~;slwlˣ٬D:3&?M Ql<WoĒ'\/)DWtXqͽ'-[)lA(h}AsPQ5,i ڌUVRz<rqϒz_q pzU%.z*|c`8z_ᬙϦǎzW\v}=~ R ^#&O2U Ac
-m=,(7Xd)`"ESY^'7NklLBnL5bf%4e3n B쭛iўg gw|
-3!t_8x\Fp&Eqf g™(.Z/ Dot gQ|p&*^^8Bv_XQ, )Cf Ԕe^d0 z XcA%+GÖ1
-"^Znh9FT?FZPfG0Sc6.Fl\кlqJNb oQcߘ[/1Ko̾mzK*48#td^:f Y'
-NtY'b(.diR/>$ݐ ѢCbrX5 |H~U2z 2:EUF]((h|v'>6O=[ҷcŢq
-k=;m
-ZJ'xKHuo_Ġͧ翾Rdԍ! ju6%|FB0/*}F5&ԛ_ :+D$tWZR !~czfYCȼ'=E{bSĜT+ǮD㰙)k%[bYP['~TaTC؃+rΊQ],pVDf/{EtVoVSQ~in,rW1XʆBsQ>_6F[E|U\ÆцFCqxFIU6D}mvᣬ#nBbI"WSZ壣{piߜ ۑy;־=?=>V>WO$f#?cNFn ⣺gpFiTonlG73EvhPzIYszG[(ch78O
-Rc5>k}ԣFk]*=Fi3E>/;т+Ʉ
-O;8f=1]֣8?gTܪs1uIu3ږ UH<<wŋZ*`IH;*a,s@d5^M-Ng2Zah>c%s.9h/V?!;}
-\d=b WpѕOBa[
- n SR(:
-ϘyKGFׁyʽ=ʼ`s $(VƐt2/*9ZoQ^ASQ|;D(x\uwb8Ab5yoZeY^(*!vdp-r,ش%tLSY)6o \`+q*㢼&'v"Kd }Q]P[RB"HQ6Q/7gݓ
-
-b
-"] 1x5QJ[q
-]#
-
-٠#;FkhWy`ϞT0il+(;R1Q`У
-YȢ@(EQR;A`}, da kC $V8"%K#ȡT-;׿<CJ_WkTx]sys;s%2U?deAa$ƺ$W?lUW'*.^psU\dw[%xbU~OG*J(DpWSEQ0cQ&Re*.hAO-IrYHKg'Wc'%.)mz1tSFܜ&(5]Ajߤ8QpF
-]V5Mtū,u\n]2@ꂀyM>+pkJʏ9 $)+) r ͩ* oD@S)D8ʚ;d@*2l5$QT"[3&H몽?Bx d JЄVv!+ʦ " Ds+5(۪"n^t*pHjQᏺF(H@URpokxE䨊 ĭ
-&C
-0$^e ~PuNU^Ē/+:AqVQQG,ep*jT
-ϋ"TJWxM (h<ϐPZr<<@&2:
-9x*XOJ
-OhQ6]HC(X`9n- l@NF fUmfRdCt`d4z+]|(г_A Hb"ǀ̓9' R&0dFyND
-rIK8a`xrB M"$E[ԈyuAm҆c:"A-\vSHnUۥø#(J,?q12@A96NFG1h1e`B9:+:ȍߩQ4P=C̃Gg>~ d @Oh2)M-5-%*`<zxe9L1Z51MZ1)E4b j O?ɚ9*kJY"s kEύJv/4L^ǥƵXVi ],.pz]E%mr!u oۉ
-*P)N&
-VomdhoTYpOC/˓9"p
-nTCgpBRIH/B;$
-$Tq9e Nl@
-hsE5͉xE3:3 b> }A$XKExݕ!XO@ ^
- &uT\0Lyt7. l ƅ4Za)" :iYx&R)b55Ѡ =!4҄(*:e"<HGiC"4@1( bdF8eg$vuhoʣ1Ɉ!/mK.2Ms tU7)T?
-LHxh9
-Ku1 #-<T& #M8Dm#CMъ[^56|H0H4%VGUȈk&p")IY4Y<2,߀
-,3fEG˯Qڊm?ɵ5S`Ȱ1+^TJF :q" Hl "R
-D28$&_7$V[*m+$0[0
-c :uvDxU!3$5s`{AXqdHwvpGhTP"'n4MY -LmFaz!/0H9)Ӵ]2l6ZGL(0* tq>Qx'cPt`hHGQ S~G>NP&"a$ .P<T 1aJB{!IԺP>AS7
-;B>N8\<$s՘a洡
-ICE=.0"Ow~7 *4XW*q*+6Q dBSiOP^%] X2eäA~F*D
-4T)GN F PNѫ%~]`LGǁGixq
-O[h52*8΄= #qS}\ahP0_hLЬ@M59Nl>f21y}0-d.&* -ލ~y@mO{)i|@f4HD$ݒsVP
-Ō0D'@tlseAq7`X'smF5@qu "7槈 Ԑ25> ="=шQ&` BwI'3D@gCY"Dn&]sdH
-)G)I6bSovEH. ;FhX'!G}7(:g0ʑ ^
-]Y+LHd2N1 *EDxF2g$c0%A]•D\C7OLB&e$`B9\2O!+$N
-bp"o0o8AJ<OpD2I
-_T**ۡCV]2YXy%$wc9}1T*\=y\$*pFzC&'McdTMb.n!Ih8TAD!ILfܱtľec'tIPZ+$$ F, /0
-BL$ּHBP$:H\dTp9&0{ 3pFA$v3\ͅփ'YǠI;dqbh
-^$YH+a+bK\Y[QuEJC{52
-g"IRױ}ÅNgpa2FI؅S5߮KK" Sq't``.p/^ `(ux**qD2YNp9D(+.b
- ]}"S^'C?O(s]ARIնwoY.$~_i? +ͫ3SIM.Ϲ?dAxƃ\("#x v]A0҇xFE 44d\9WȼWstI Նg@2{_7A6kޢhѼy]{Uq7Y\㮼kif͚5'hyͥuͥM
-_عy;/w0.zҗ6g*0v8y_}uqy6rn. vwΐ'
-羘1?9|~y/?;u^k IVۺЯg7>nt@U0{_CΠ.3wϷ;{8éE?/vpo :%p3J)FXÞ[Lnwv7nqíj_];(o߾m۶m7m X:;NGL}/'Ϝcs:Kkl;wpBum oЗͱ oڱm57nGэd-]>`{kKμhH&
-ނ|rgnΰAz&vk* V-[:k({}SYS`݇7.mxe <8ixHͣzr3.BW\
-0FC1s Usc2$>,:6
-0c*tYYx&
-=YC}M5,'_ZLOx
-nh:٢سwn;7ES8hTa1+owOJnoa0|yk۠a#|̾ w\հy\vS%)ηi/*%&2S5 ĥ- ]v:f1|/3Ǔ5-`̣ wz. f×wM<lIK3MZk :X u>4'gDfpxW61Aoiz ]eegMO>QڷdxȰ쬴⇊Up}R FfV"<٭0,* ggv1_"<-)* /Iʆ-`2uƑ.gXFnMO`s\vNїCowʰ ?;<'+WB|ƗWUܡ}:wfi cԜdf!G@* c^"#'/?/'fe 2 Yj 4m]a!fnA3tPwpXC{G K!‚P×YB߈촞ʭP#b򀬼‘*c8< dxм#Gzs{1B w847jdac8<01<fa&[ Gxa f{G}>zpX"_^&c8\\bp]Fe`_\42//c8Lؙ
-pQI(p śy ppݠI[1|p cФmnIe G ײM\S3Y)oj åԖ1Iڛ3#Ksú\f0\\Zg `NAʰ3 ZpcNpIS;c8@ d (kf1>Ñc8` GH1i0# p4Ñc8` GH1i0# p4Ñc8` GH1i0# p4ÑpGp4Ñc8` GHHa GH1i0# pAÑc8` GHbXd G&Úh1\ '0#<XTÑ0/ȰPp]|%pdb;vaܱs'u й3~՝1 4iцS;u钀 \e %\;u5Aqڌ1\ڲرKbN*c8"U7)'$&%vV;0#^:^-6ppI[;h]ws5g =Y;&v=Q0#]HHѳ{bGpD;N={HJ4oB:DJ39Ac䆶rId GMnhtѧOopФ%0ܳO;w0#&-T{Mӽt2+%opdФe{-wJ=m@V0;<|\ڪܧ~v7
-׻{3#Koؽ$w2#Kotw2pЀ>ڝ- L馷ou)2ءSiu
-%#[z
-
-<Cuo _n0\L
-۶V {F1 BC\{c>d؎-(y#F9=a+*r,OoDAvZ1nӁU xGCg akFCz1[!f 6QY~ނYvƍV
-QU dNf>j
-9dޝ;l0]xi=edྑ9k w6xpZmZ2p{{ԔzpP3-RJfajd 2wPZɌ0 İw`Z>.;Z ߉ 蓤c 3g
-&åO \maOؿ0|=c8 :ß1<1\` G`ec8l\a1Ñc8` GH1i0# p4.pWp` GH1i0# p4Ñc8` GE`1)0# p4Ñc8Ҹl#\0# p4ÑaÑp0p$ Q;1q;s8o3|'cw{axt ^ ] jfk; Õ0`xDv5u
-}s?0q⽕nÝz <dH^^a:'=QY!BACf܁}.,%CSO}a=7q]eegMOqU>8gN4Wk|rٙgBM]J6k'?P6g2,$ MʾU{wSΟcW1x;;<oW[y\ݴY-P'hѼuWGʹoruF [l&׭3s_\4)DRlH(okH]s(k٪u;^V :uFt+:uJ訫2ucK-8,:kbbReT>_^b٢3& 5%|\qsp_R a%4fV7+izMHԹKR2d K1<<O6,kHFڀ>t/4eOg@̬Pt,'/=n̹^Y[oZG Qozg[^ 12ڌj'j%]Ik; 5=##3sH %W8xtŘq &k|Ą s壋|޼@Сڬ
-z
-|Ecaѡ?ć'O{/.֭{W=9(M ݦ A,}߄1ŞAnYKAA[ueTOЊmI0;p'//;bTQj;v'>2ef=SO͞=t]
-lKTCT >裍7~ gm/y`Jힽ?p;u|ԁ_d{͛fفS:|O?9C U KWZj/
-i{`b5vb Ο wiIn d ,w8 H_` G
-o:$UtWJ=e]AĻ:$]m{xW?O?߮ |^d=!W<[`I[Qwq.9~_ƺx54s8? N1^nIMn%s J~B,*]*u^]E U$Lseŭ ޭȂU-k<d7/+n˂[/'3xxGn'Mtz/\(Te 47%wگ݂"+.,C!t7벫z-H$?
-unY4nN%ey@/
-,o%7'p2qF/a V(FoE[ST(2,IH/x%ޣr!x /ܒFkD*uM%Ttݺ[eȎ*I.Ip@^P]<ѼUssbgCa$.- K{]x|&$eyh ZKƁjDq+p&B+nl:yh1YD:u/R^&r>Pqh:zIyۦ{2O[\RM:Rv+IeDP.QDlX#?i<ޯc˪M2-$ H8 A܊EÅD}!)A/P@5T5+*PD{UWQjGՀ4蹲tsD(ɜ[I_5(
-UU7)Ԥw듔V)ݰ5^y`,]%.j}!W\hӂ<o.y޲1ނܾr&O,.)vIHc%G 693C\I"U%ڙ@)`
-Uhn@= ,y^Q1/Uhh1nj9fB+,v8U*t-3+g+E/lÐUϤ-3k-
-
-bEMӿM 4N9W6t<Epz$6ՌYB5/Ppj9VKtZ7[U_a̢$ěE]9efM"t|ޠOin3=K%ti Z/)*ONֽVX:efM$tl*Mft{ 7~%I4E
-MU?ֻY%tgºӪtK`Gռm,}12K fx`{LW~-d-UG
-hٟ͚8Q[Go6$
-OUKȨTŞY>!0B끶bY"fc[/Y
-gfY4l lƪRՇtfQ%360ӵ3g=XY"0KdzYs6aVl¬"-MX5^2[e0`z^e{fQfzpt2KdSf̚Y5nئ*MU|K5O%6iչ!I!ӛq2fLLwɤ~i^ifcpSmś-eVg[XwpgAUN-j<%Քh[1
-/..(j
-;dU}]_UΨ]2O<ye-r>cz˸&EρIk{PAvWPYQI,CZ}m},G4gSS`gBChiv{ӓEI0:J[͠AwMz:6ߺA5>["͠m`jCF8QoNͪp{;p!|Ј!'7mrDwwA[f͘K:xIfBf+_3憛esgtG}ɧvꝇc=h9SO?N>ྲྀF:<ISgv͘6C~@9O#'Õn"sþɞMen7~LDiܨ{rT]Gs;1Kg͹믹򒳧useÁ> .sos̳N8rNq3g^9o4KΚrW&sx#N82g5ͷ6!A&1uɬkLDnkQS622L~sxѧ;<c>892Qamxt7 >м[?«o=̜ќyE6ab>4̍}<be$s#gȑ'_<9 GٮM4skod^tґ2s]ǝ׿k//Y8%ۥ5v ]y,}7_ynx؝7Nut^^y㭷x9#s洱;u< 6Nc^|ü^$̹=esQH[rKn\2ͳ_9/>ǜ?ů'|W?쉃*C&_G^x냏?לQb g\},[ɪU\Sٜ2{T/dn59~uهpGkw{}ε ~Lgç\~ok^W6>_I9y˯׮z-Oҷ;>^t//_fuk׬Z[gN.gI+4wo*~.|2 ![/os.}ѫd2Isz/ۯ?}wɼ+PR>G^]a˦ +a6yK]1yzUSO"$8bڕ,L0[#e6a>ks>˼섡mGq7?]+;W|O:`
-lsOj2WU'؝́'_+||\f7fs=?Jod'9S%YK̲/4O^STRgRc|k^{JsۃO7$ٓoXfd>08ו<jZ߭E7~%ꭅ7Vl}MO go?Q.0o3I&2ϺAfr62!2TL}]p +ҟݧn>st[I:.Ō<yܮгoyzm=$39fO2Ϲ72-ѽK?
-r?kLi ;vcϽW21{22{#|go9{L{IGo,,z2,aWN_8W?{9W`gJ vK>ٝٓz-QfcYR]SM
- Aެ- 34&}EÖll
-<ThJ,[ߤ)}`3ݘ__=ˤjyףpٓzcGԘ2^_evLzיf\A-ѯձ Uӹ@7,t&R>+219^Dz3g)R,˞<*/ps\[N=Tu2{;kse>eb,_ohrؠ4hi.id>z]驻7pڨ*hȤ֙v[|ל|`I|W`~9rG>2gF/ޣ{-2sMDo`W[uYG[~<qdtŴ2g\˖/7݋2Sd:'T{AQ\K?G<uk>~{W:,]o<u_x]rߑE 'ç^&z]ן/9`+o׭ͧܽ2KY"JvӯX嚯VѻK5US/?5k\cְhU.]kj dIe2iGI抷{`yڻOwf?b>\هMOeLŽieޠ27xw?Xr{o螫s
-;,_b?]\| Ͼ{oUfl:+W,%~ũGZ8{Aw:Ȳ5zγwҷTcdnDbW<r ^.~񥗖>#w_7sZMm(1,|K_XăwιhalٝΟsO=Y&y8 'hd>ۮ:Cv,"qa /ɇ悮;2{+s]NQqǏ.cna 2?ff;|߮xw|ŧ=rMK*0'ngw7κiM;֍w SvN~w//#s_'^8;ϻcO0w2#qEWd7R <,/?w}9ؓϝy٬}_/<sQ{By'3oWΞ=K?}JA27+If灿f#N;g͞}e3|qG a2+ÜuF)iOc&LzaߝFu,<y7~Jv>casgL05|ร'L;v1vno 9iӧOr1G:lWo2I9xŸzI'a߮3l!9eډӧPCRD ?u'Nrܟ&ҜK a#Ua;[I6;=(0G;hDlږaSt}oI31%#G>hp~y,3_Ws?aޝ2qK-[8mʾ__~d6r~f}7MdoC~&cdnla&קuos`3ۃVz=ɫT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJ?*j͠mv6v_5elUf|/sf,s#2x^7jD;={/"5vcȈ=zmnP*b͜?r!csRpsw=y}h=0j-
-7ܾwW~aںvM8yOއdpޟʘ[ <ϼG>d>{g99~>5Ly w' Ze<5oٝz5wϘOϿew'uTNfS^sVۀg__~nݺ>_wK*p']u>]v7'u'gŷ.|egk~󍕹 ~Kn_}y{Lbޖcwf2\vݺWΜ<o s.2׬Z.}/2oxҾ9SW}XRr_h0?{WN>;q)W[l߂́#]>[]N2ĜܲϾΖsi#zb~黋|ʰ2i; rU.wE݉|gMf6欛|{:.w_}sfMIz-O2|Cל|@ sO桗WVe~L栃fyd=Q/=xIe21W6N:q$Daԇ] o8mԠ
-lwǒ3]jsۃO7>]Lj T߉<Tf#Ǜl`~k^wJƻz'sUA"sϿ~;Ot!ۖTv_p+^4Kmϼw>eR*APdTfn[ V*čwr1I "w=/ZeO|趒
-t]tϋ<yә0ͷ2ۨ{~9<ޗFf#sSi]O|錿ޥj18y/eo\a칷=_&1=\dRJ&{RT-nzΘ
-t9fkۙnur+ ~dK5wL_Ϊ5/CU`[zx~ݘOfi62P*pe6}_LfIև̞^ʊ?Ef.e60DVmdM_?DO[C6{C#dO٧QVF}Z?|:FEfo/Kٺ1t6ݒn[3_fs~ռ mЯȇ2L\ÜA;._5ܮ̘$tMsssfE/.ѣLhY|uLO֘"s'715ZcĜn7?Bfr62q̘_Le_o_}#M c1].7TnܶAd2_25Ok[Ĥ?Zϖ=7KpBV XfIl9fO2 ?Mfy98#4236fy埯5VwtQ.]F7_uZTڿؔ}Ozңç^~b\Gw_ۃLüO_ sĴ+dgůKdk)|5?c)Y2rO_^ŧ+\Be }9›]Ge23s͚/{ieFřU?@?t2WycKLKgc.{3|cw:H^l}9y?w^]mWZG6뮅/ފFeҪUw/|eX'yUw/z2`%\=2(| e2޳rҳ?|e3[m K_\ăw\}wܼm܌4g]xm\?yГ-}en .Q&3z)?^';c^t?<~-W3 #tڥrς^q޴#^R'#xڥsn{}Ϳ/;w}2f=jSλr
-kRa#vR-ݝw#G oݶo߬?.?|ĈCks wsȰ#O:{e2s 9t[pv}o\KmٴOЯo{melF&9`=D9j&>H-O?T1KXT=ӯnu줱-~;;i1LuBm҄'=u{rw>uۚg1nI[g#I /?f'L<j4rZV3>\i.4ǵN>qZ7mesxK$7.9w5o6Ϳ\?mw?m5뤭ӞF^//i}
-v+`G0jO({3G~dDn{n^9Lr3HrncR:qҚ/b,7{Yn̙n{eMN48uO<zbkJ֝JYӸ"lo~2:^Y9ݠ=sq{QAaT +>g石w+kY({B;ي*)QmN°s5d0nWa䴻iBb݉n-4H-Z na-+L波*>{H+
-{uCŻ~*>sz{{^&^RP
-]gl^F|:ACg։ 8o4mxi1 }q'!J|PZaYI:_)Հ!*{5i3Tk"2m"5uzPׁ釽Qx;dH34_9Tj"VV|]gutf5w!^=򕝃.\P<'__cӠ=LSNMo'C򵝡ΡRk;+uEVz<: ^
-`[ᦵk4)?.@(ZC&LTȰ
-kMUB^\qUmVղs5Ap-UIVa0/Ը}>ցE
-ݭ{k;C>To*S6_٪ Zf'*u&jVP
-ڧm *ؖPln)o:؃(jۛI_(IP_Չ5͙ װE UlQ[V%[b#{ }\!O3i2Bgԃ*RQWU\+*Vhւ>UcoW[|GQ>
-@Nԅ*@yz9vT1Uj*U5W Ճ UUjA}j+Z>_*}Xn|v^΅:͡ZJTUTsڬ@ZT +ՂV֌}Rm1j6q*=Cڽz!5C^UmԊU2"Zj>Ui3 Wom-RjؖPln)qzk^ې5ĐocwܺIGN:f8чC&!;5k ͙݆4;v`CC:;]ƍ0QZ+x&3?[֝\d?Nn1 75^j0ʝ?4_I"G8q:倝nHC0i=5(=F Fadp[趧iZr ARdZEۍnLGK0 ]*; Ȥi irLh`N6Ej&c0)6HQJa520
-MCq.8C-^/V4E8[{,r@Bm.ORʐ*4b3޳ 5O
-d7@/> #s'XS1B "uf9IXd郅IFЄ*j;lgm6˧<+ :Wqb kaKӕ/u;%u9(r-e "I]re VR C9ѮRLEGK\ec _MԙET +QW2̹8kz>KVsQ((h
-V\VE e<x<ae
-Ji|
-d@s3jOz=b@k 0GEsdZR֕aveFrRRB:bVkLjf^Dp3UR@U0 [/0b\1!E8E8<P79m$γH 4_hȗ̈ErQ*`
-njY @r#t /*kʗaDԪ4ED{˜ga! `t\L1XJ0%M,V/1/Y31Y萩QxԒ ;~z$לiQwFeK0f
- R2O(H!(` [ Su`z$2.Fu Y\7 |g<*D
- +U)N`e-2T
-yXѓ)dH7u(`5-IÆ5ee H
-OQsHa󢩺Yd2? d͋c[(!#U3S ˡFǑ,,ފ
-w-ߍiE[!!g,iH%1`{0-\Cu|SܞHȆ@%]k+N-rFK`#\Ix0 /)3Y7?plim.U_`  Z~2UO"Jhm:ƹv
-q͓O_ųrLG/ Z
-qc9bz3_neSjWZ`fqeI\߅2qWtH{m` #Xe\ @2cZjp+ElKpJa9(h܌CP7`+S֒aMGqJNDlcKXکC4,帼H֭$esԘeAx,? / 3AcO#v!2A c#VD4c:7@bo3}d,i2r M^x-Y3u LF
-ك.gdKBZx$ǣ*C9Eż` Kck`NS8<\v"Ds50*S 7.T;ǟ3ʂ>Dv.!#$h}sEӏY\8\+G:8fWqa3F~S# #aѥ^א'q4kc:Xae>
-tPILw ǃ%!
- |2r\lfX|}#߽,pIvdH-̋tQ+,J4T=cZDbq?"8VD]YO4Mgic`I棐 @d:<VwpΦf
-g$̄x@$_p,I3|4/,ҕr|~YNB/h.3%8(À^{j2rQh$F
-/SzfHJ[@'8 -4VKI3OKQ4(ܷ_?Zy%i9 3PDe$j6"5d43 ")D7AkL8OwO5zOמ3zM_}NDa" hl:uiY3h\aBmnľ
-]`/eG͍5E C5m12ʉcD1 H$I9phmRsT|q(E4F~F0HHP!
-Թs8d.y]~Q|%FWR %* k!$,c.4]>ԳNr#RdZW
-$bC,,pir 9% "Ѽ4,rAЉvûZ,Fr
-zfR rF,^cb>! j:wiY2a({z^
-hNrnf",w
-<sjʕΡ7qy[h "\p .6\Zah3X )| ߦǮ\A!,>0IaJ̐Xa&cfa&ǥA/G ?+R#EIZc#ORp%E8?l欔4mN@uBJ䒂NʁoZ|/T,rsE轅4IH>D
-(burZk$A: "~[a"
-]Z+4o"%- $%Uԟbڸ }
-l3*;5]5% ƈ6?ְV1Po$ s6Q(Õa(ve0a+bs<B÷_cn!cY˃}N=0I|BJ=CQN^^^)ȣ&e͜K|xD<rao,tx
-H<+`&5X6{*xHψ
-@{H;d J
-2E~LQ
-,gH0Z"S`Eaؽ{qةH'y! 4:^]#pϴJֳͬv|(Po[z|3'`8 '
-pH%YY.v0bq`/pvlk^E1xl,NľΓ (`
-Łn8ތ){
-t
-ӍYYƧ?U~X䤲jh.ZQ9b*@ADxE~l!iKѬuj4y1'PdNoET%\JU(cP5FeO
-[8f{s{ri$pF#:/`L 8!dIa3X<0!'_L c2,"T,Z<K  *tߌ""'Fw'p jfbKB$"{ n(iTv
-a\l@g/$wW3'ŷ d$ԥ3z0uf0-E ysbB
-@ce*L$$Y~,л#[G'E\e)\CmeH$_رyٷ״Q7?\J
-18l5vNlhw,d<@(WCk9\XGۗ8tMѿ6XiĊBC0hs"Hd:v sݣij/D--\ d~C۟-4qYfj\l-y;X s I ~<y9Bmz$]k.Ԑ6g$Z㥦M:XhpKh!@:pe,x0.3
-F==YY} Br,TKu˱X=VZжHBZ!C"Y@#AߙJ0nh9L/kȮgeA8&BHN+izh FR) NĖAEp&w%'ʗ
-Q%ho!1$B!ˡʄՂ%?$(F@dRz0:G[,S"V@@8P/NYlmu wc8QC9d!c@;6"C~x\![àbŒ-qLoZrДhsvN}BAQp
-/6si3!" x+B4] ƫYC|?'gI%\A0 2(DQ3x^t_֖m`eafЙAm|‡_+"Թ)5#>: u ]O;?9r@
-x}9x65,'q# d+ccdL|s@5<1JF 8 2xߤTKf!Q"I!.W0rB(]#["$dEr#y9ry#k!ˡYLWT~~:\4Aᓄc5K1.qThQvQ9-b&S0É!ZO%M6 mf8|Үb9t@L`9u6hCHawZ'u
-^d$
-Y(҈*dlra<|96E,"e
-ZR,`׃
-=
-8 0GQ[R "8&ź.<J:-àqN9#BThڦzHhˢ$bXY<zM/VO jGez64}LcT)hU3[rf$m1y+7_nu~Ȏ%:!}=̾OdWB
- X+5T:Q^pLCET}䩫+$Be5GTb+u6 7{) 6i Pg
-Cc)
-e<M"c)n<d:Xa/3c焳P46,GTW@+͉g.6E]v@DfZ-"u)B(#+d9V ,Q㢲+:612]
-d9miNZK];5 sz
-K4yjG{1B_,5i&j-vg]CTk| ͠P9I*)quLϢ L7fry^g
-Xӏb=.FS/#YƍC^5O;dG> pF+m9O\RD3.5Ej48GH +PAr=5
-d d(jgIs1bVZm0|!=xP1)0,╅m`3]rPc/|@C d$mڔ5$ \"Kd{Q-Pgyz,R׌ UY!iC<(dLo(d1hJ:O#a)donpζ77`sS:-B4;Z(XӸKJAHP ҂*xAW##)
-Q
-Q2aQ
-5KenE&ώrr퍗K8բQq 
-kA[L"YafJ(eSb ,g(>D7&@Ci^a5 'K]
-IX8`v:Qd]cѡ5b]_ⱺЩ[b^׏$r8'-DK=Z }w\BZUZ&Iu1E<(/p*Vhk g$d/z8׵2]\Z8Ý"lmVD3cKe$x&,72x֏͡(G (IO*Y,l)6 :-Oz@.8cPfgQ[ErO6XӋy 2gqI#Ȓ :z^&l䏑d -Q z]'ˌFV?l(bthH +49|.yS;t,GY&=tÉƼa\e`ND[p7t䚊Xc
-UcsZ@Z 'A" ^[7*oD0S"rku+"Ƕ)!!2ld5C98\h,<޵y:H#5 TDpqP)_Zi#Bayk[! D f Y,<1by"y7ZV쉷&Y,
-3$F('
-'`i#vE:da4  8r+OA1IGMOÍ}~@A%s&9&F Oq=cN!oQ6&?ta-vqt G9M(@q0B[ChkǹMb NXFyp0C3W
-Hz |PfƐ04 3 mlzȟc$s;,Q6`iI1bH k8wFh
- ' "c?\( i
-Y,<| QQ:#*(}fwGdC2,`2yH“^lFA|Cdp" `
-u鱥!3ψDS^( e Qv%L_&z9@`%klXy-P :%nhjeX`=o!]>zK13g80Cy, Q)11Cñ֓8yz]gsG`wj "4{
-两I*T/DX
-~-8
- X
-
-+Bԅ❅@MRVX}^ng/GҖT$:qx,5p,UQL5"jiVL93J8^mJ
-{N5}&1*\C[TӦx͓pK@bz8M6%E0k> /
-Kj.WJW$Q:y8R,,{02c4іsuDc> [Zd@wkEIYգpkX΃=֗:knG\b1Iʇ0 aKʇ#Dl)Lr* k0{Â[dbJd9Py56BEpoˮwDoEldecDtNjA~.iX
-o8E.XvcʔXnGauGK3/48͡5vI܌"u7$Y)nF:ƘwsXB*b9#t0>ԮBX
-jQw Jk(;H)Ov;qGT|<uӖ ||5t>-28Apl@NSGrEA.oQK% _$|;,P|ztb;0Ӽ\2 E"
-Vc*
-F,@ 17e/@<# +mrBˇżЦk^(cY{W-7l3!-XN
-?z))=IJ.#ʀ'|;}+B1p l}ҘԝKuE)plT?q8AsJ\[@3vCaM2=xQw˨8XC̈pG=NX
-m)^h-2( @p*Q,@">(b<egl Y#hKOXB J  0hGp$rLBN?7ݨbx  2ޠgV0R+
-m4S+%!V?qfZ @MEC+0:aέKB~e2t)J1P@ chIe8~F (~OPBq"J+0H)t*nDq!.%(۫o"x7>8 o%H4=_W fګ0$ Pl<R`g, 3 hўuT=Fˮk-~3,h-
-}jT1 p_Lfuư}m
-gdJ-c,@?evGCxFKOzJ`` 14-:`(bNd,s%-Pf d.O`qd81 `60hqҸ^ ЯK3F@7`h4ړ́@f=K :q4)P6)XqP cܞ. YYhހva]S*,,йxu|FV[Px6fц/VGF
-.f /Бi?N4[5tm?[b \e y jIN/1 "Y}kEJܞ3JB2sѼIN
-| /5=ٔ`r !_Por fa'^x=8_ş]
-טQElI::"6s^?Ix uO_7tL}F h`IM!G0"bv2c;[gVĆGL
-4"h
-"2dn0
-lj#bǚ\b Ʉ-߹tGZlkb{.R<.GVgݛn j,u]kkwS ? O!s(K> ߟC?'`[LnLѧG!Sz Yb*d/9H" 앭9;u-j.=P$wt0ɬ*~U}Mjwћhhџd
--_'pi6ހ7M-ކ4m`JZGFreYI6sЧF}Q$u -B@pBb`9x4S* ExdO_4Οh?}FY~O[ikik?m&M?>ZJ,'SO>ei?>gT="0l[׶[5Qsw_]Z34l{6?Ra> oS>W>||*$ ¯Hөx.4?翳PJ(TE jm!xW+;#09[0)r]<OR(AQ<-P Š-HNa ?SPJ8K~ft6k*<eADT_UO]vo6E$py'6`6[De-P~W[UZnh*J5uɋ28y1,'4
-?Z+&
-{*bXd8Cr 5P5i!q._dIcmV3+4,[\~ ֖XimIf~|f`fO g[SSC^YBy-Jp<gVUgKNrV,Dht'p?y:ZqRm8-qCK$M(ɀہK(8%vhlޱ͢~ <-!nFC͆XC ^4A$
-H!;fDA*шLF[)F1xP/!K1 !$`
- M=⌆x@l`b,
--" B^w1h Pp  E
-< V_uq#yZ$^,H))>6tgXU"OI8fEMPnw,zT,f1uxCun` 3 T8ضq74L@ִph"mZ-^h@) DX"`e%!(bZ4K Ϙd(4;V
-fw 7],r,;JӋjJ#m'K#8hCޮuޕހ],Ue@} 6.@׌p ڊ
- 9lྨ-&,6Vނ,`0^~_M)TODu8&89?t- Ņ"hZw૲Ⱥ/"ЌcAWVo2}4%P*(^E*%mMhA'7U$+2Hw1,TXkN@1e/C
- ;ѣ'Pe2b(`)$A|7)^!,L]eYO]pX[0o5P&ӅM^ھ("0< c$l+M t"a_I3IR$ cR6X1d_E#<ӆcAYJuc(pÑ
-1WeNmoزsfgg;AU봫N`3ω4
-ͥDylKʙRM4Y _]$iםm@{ـ#U\Pl6j{a#@?mr={+T[jIGtL,6,ꩆ^"'<aCCƏSW
-8zKc>
-ik*i v\w1E)Q$ì VѴVzbG+Qq+~G&]5 co?S<D"mDht.i&/iL+[U^l il kFj9_-?cTչ4樫Û ~ڕ& y,ֶ'kfiKӼ G[-"7%kw:!@KM鮖x!rS?&~BH6yd_:q-b_քD=p3=ufL>0)xǔ1 `踺ʬ:J16 `Bc?AJ5~Et‡rTDV:s5ٯB )SXq/ԕ,] 4XL]SfڰQU/RI|C"EGëC?'
-9m|m8NMyR@CUԞ4iąed,VHL @&0&,vhj21~x+ftaN5a2N\:y=NؼԓSd[o(W>X`lBb5
-mE vVY,2i8Kb.iBUnNZD<,{!Q$sU{siua r-pr?mڣ ^ϔ!as(CܰV2WF )3gXbE+'+I=7nYƼꌔިe"~ 27;,Ol[Ug.%p6ekPq^$8m<1&_DrR{Z<~rU%ͮe8_mֽ
-
-je*5@sY洓~x:'쀸l|!ʄZᢏɳq1]lе{ +>;xIrrG̈#7[./2O'reK=^OS͐sp#W'.z73bcg)//ds+}z=i )ܠ2˜I""rU.T~%c#ڏԬX>,tJ8J-6 MJ&"ո7>#ҙ t9|F}
-Q|D&f.0wBsjH}\HvBj6"pjĠ߁DLuɕ1x&{QT H$rA*{>tga^-X
-ͷi9U{JW@n?OoBz;붹e%~.>@/Z0v
-'d1\]N\e˟u:DÐ{Lnzp^eW0 :]$ <%&r1e2}-
-5VKdLì5QlרE bG1ˉE-j_1 c1r 1Z/{ν^'L̠CD /糾~yN0@wO 0:vQXfǁr
-Q뙵5by%=3@̔tn]<]L34AH9aÀ/O)1VLqO|/6Km͘f->+:f&
-YWY迂)Qk:z<ǽ+Jq{_+De!ތ.fa']7fC 4h!|2G3^(8m |r'A~;F"0Rvrd
-\_礗a k /, w5- "YOV4'z\ʝ2rsK^]CArsZ;2-c~C 5w^KG̀ 
-y}ä'tDc @BS}\b[oHb;Z0Fƴ*Uā }qt;|6`w[_Z-V(}bqI5Z 7__ưɏ)ih2]0#:(AǚlDeYУY.룁&[ًU06(vh'IC<;&ƤnpJ*j3[MrLtn8GܧM9O)H/VpJF/_y9򳌞h*f,j }N+ o!x?4+#Ͷ@EIGÏ, e9 }3$G0[2
-GN$,# A6V
-eՖc| QN'_+`F X˹%9~%A9 lϭQ ʘ9Q`vSj][HjKW\VI5ɽ|ɉ{]&tݿbЪ-cjtSY*L†4Tӻ\Vp_y
-\tfgǺ1 mioO*`RM2dXIRSWUìǿHs0EVeJl`.Qbdd*F
-\@q{6~|z̽J1Ӵ;5 ܺEc=+z~xP_8||No?r4
-% ~/aH|DeZ!gd >^P%?$GdԨG4c@>ƿ1'*+~: S7i?h}uOp;+[^OdSD-U*{z%^d7 _Z.!
-Q9{(M'.2z3?Å xF6(
-R=EB@*K>]}/@b:fQ}cѰ| 0a F9Hy`=y՛*P!oU|>k i>q!㜞p\]
-Aٶc f/Tkw`5Ⱦ'Jɽݗkv9i{Զrp7GJNLWvrvڹ<ӫkκ.\dg.$]3E{dzCړ32`OGY{lϹS{]{6wˡU^\^ws%U7؛*c&nի~s`yOWK ڻF޿D>R}&iͮ[f_^V<]uN;v2#p8sduzr p:bك#I͑5SqKGXsUј\vqKvRivt
-NMTZ8^bgz^^Ԝ&wV:㸳p8[8Ź)%)S+U~=q9gȹp OO)+v(,9-ҩi5aOEN"uޟe:/ a=}sYqV]J3L\g+M j䪖>W']i2~s_Rwޗgܿrӹ1wN޻J{rv]-w0*t0޻gNؽ
-:ȍi?=؃']VO{sOG=OQ3niY@yq7<oEWac7*Њ֬><H=ob^N]'-|L+i޲ _=<n.2ߋj/D `Mʾa=fEf/ҧʭJ[U~w'҃<}>(A}Ċn B $Щhɱp^B8t4WL|2xRE^ z gN{/t.8;!Ǭ5\@R['T P}C/jhnBaݝ9.prvb68.HFdVŧH-#wO l%A_;9+剋eIѽYb𒮒D$y鋐oD$J^<EvɌJΊ6zSRP-u䩷C1:þ\u> O4IVԈYfLw3s?]2YЧ 60/Y;B&b#5 -9?} K˧#Mh>s݉w½np=+<ov}M>-ZG8+B9fDRPWYKR"%bݞWљ".~*;@ghUZ+vZ1&SDzY">Vb΅'ug̫rVJg;{ܽC緙x/Q/>-,Z">&.R
-+sy('.ڼR?6dV$S<I6.{?SqT;LuA#@9~MWi<'SLϵ^
-FջiW' }>_gȸ<h O\hYyT[8S~7xRxs:\sfx1KfF_=}Γt7U~Ս5n߮w5.W {j$#} <:7x4Ey8^}5i{4k<bu^]V{C`:c=?^ΥYJܮHy긙&ɳtD/f<ì!j/Ջ"QGٜ"jy2WpMxIotX֒Ƕ k nDuhQ7>Tfb7)6xF[mϥq [=\1sQ vsZ*3x2}h- 8ow#D$P GK(m21Lgba pHq0Rx}ʄGw  "N> Z+9$9쒀>xZz T+ldoopduw0ɸnSEnP1i+fً)nY֞pߩ
-,gB~֢)`9pL{X YXDUY@wbx,Lt\;qiZlq=5"4VF U;>ŽH95bGHX6B])Fz9. ޅx
-Sݍ4zD{SGvK j4#{<[\eZ|am"}R(m#;>Z{Aӳݧ- ɻZ...<[rRvôREYl=V|V]H|*)t{ˎ2D^mv#-ytiJho!EX0=<Hs'\@wHS?'
-9S^.N9Gb߿7w=xuV$c53,aV U %v?o+Ş=Sʞ}yZv4kΖwkS㻸Do)O[|~kj>brb?c.^-3!y@Z]\b3&؀:) NN#ՓUi9JFLuf], ʈ|&e2H9߀fpM`ohςI{P(sX*<D$~s:#Jsȑ[W'^!Պ5(HG]+\+Rf?RGً9uhAw%!+E` y^+RyF
-A2Ꮩh1)n.H'#O]c H߇TFHMlcJ_G
-}>R8+uWu.#bk84A2Zd|u U6BگfN
-ڞ:|8\ ʮg| ^AϽ5X׳lM%0M4,)DݭAo&uΎLd{h+ uvǬ̌ dqQ 0ĒUS[>0 7td$g]sdvuћ\IJ"ʐ :;W߉f0\+1>c1]L&![u~rKZ ")E-!wR8V39 b7a 7ߣzÍF҄ s#MrkVN]+ v}7+qchdCV .<[X7^MIB}kT؊eލG[?y1|6%Φwy7ؔlŴGV]r,#ufSYrݼRo5ͺ<L!+AS+yW^vn}8~&mjƂi%k{'A֮vya{Y¼Մ =VQ`{|5 Zu,o@JzOs,?"V=KTNg+ҍE.Y>c<X'>r鎞!K[M}nUn/<_5iP~l/'QlWDw?b[yem+p7O׷'|6ER<^읾fe'P}+Whcz}GR;> ms4¾R
-eOW6;rtԲu w-pTG-?~;2>̖Z&[ȰK7toy-- G'A=.f>.o>r;tN-G~x-m)[<jl~]+ݞ<7${ؾ^I2=I2)I$'9$99
-4*" EiRD Eݫzw.۔$3g[yӝɋdxTMbTXU6qi-*2
-KC |5pfnեXkOsӵay%R_9 V+$Kфvͣ)ھeXURSJ(R0֯}麏A/6 uZ,q> (krfA3kf(q[,&ә`p5&7mz?vF#nP1R#<Qw~uQM屽M.ug@MnRW
-j܍O' {*z1VVXOSSilii]Vzl&rl:*ë4Nr,],T*Ž^igD5✛f{ a *w7׍^3213Djw%Ez1ཝL]^ԨhF(ڬf:3{hb6r\nE
-sӍxc%+ߍb®cGCF+5콲˝IcWFNdo2Vnu(Wٻy|Z.7;ހM3 YfEV\+zs{Ԙ年XkP"*u^E3Ru'Mcg6$W}vUn7g}J֚GJzS4sVطbU `֚ҋZM<u[S'k#T`A*zC/*OHY85t1yJv1|`x_ƻodPZ|)bnv1ömkmRbk20K׺+W64dQ#K1E惚IZza4o6I\;cqCFyҋw-7b5Tbonf7db VAc_?1sUnM-.47,ـ8NNߝ][ɴlesrn:95kr7&oAW3<F 6"Kt:т5ЙGI9UꎡR947<S:/-GG VCgA'CgArw4 </ +I~fklfo tT-iVzMY9n؊R-1=k2ѯ‭|ɍ2jIexŔ$̖?6_Ŭl?a[ >TMREʕ-ɑ\VAsf9v9l@5a86vѝek\6{46RxMn`7'dM4~cfdc*k:淳Ԓ3r"b9 ϒƭ/vJG4å5y=zfz+'=V,\(m5d!i{1X:3\8#݀z$O &j0QՎfޤg3+E~^i,|{#/ `*Vf>S:!g9"OYKe,lY=j.foS]^Pb=dS/)"UNz<fk,[i떖r@h#Y,[vdO^O6؞]*s%'(%;ƌUi9aes-IT(%LGFa6raが5̱6*vd4Ӭ&e H-(!FUbU-^.)Ɣփr2XT˕+;q$_ֹԳ[ҩMfI9U"cNo-WdO+swАF+25{Z{<vWd^ipcVd|n"hGSZ[ձ"#G ս"Ct݃+"R-jYѬ<{9V9lgZmyI+ˇ#߸HU^F
-sD#60nSբΈl#y4o=Nrb2b9ʸ:Me\]mNp9WWB)l B댓TU^64s#ٮu# px8uUx8ժB9"pxVxx6و?N\kt<sϭ"8K@#t#tc
-6"Mk Ӯs#0UffW*R לP^Hhc^Z1̼6pm lDlleR6Y76׷;zuT!}=S8.2^u+.H
-dn7).`'i3
-#ṽ.;?SriI1
-7ܘry~}ӻ%U3>oV}>sB<gDqKYj??~{XuSU3Z=utY9tFF Qtz#ⵞGi5 NRG)Nt;#Ӌ>Noзh:X:
-F n|J Ӌ6_w4*27.NopYm@4T'L5$N/NLz.nt4?N/FUYb5FX58뱂zlوh:X:Eܠh:ݒHat&F44Τi`4xc
-tNbF:?9L
-Cz-YntChk겜:
-crS5HfZ:/tS^X=#Έ*ݬ5mtg#f_q.Wy]9J@dtWk̘)Uq̝Ɋ|]m vkNfk;7[G_h1f;yFgq8 %h 勡:=]v}'yL31ξa_Ic茝8ZGs"e&<aS9Qx:7AWG
-쒼ȍvXbcFyC)^|!QZc\JTsgN-PA$:R:]X3 [-$5bBv¾v|Z_˰(o3,J^M}g+tߌ< fF>#E4ÙF`8c#F۟=Y;xWg5ש?KxzOS; gIb3/{U6C7 +ƜpGQϭ;Ǻ愻NʳOdyR^CNf9:~{*> {-qh98ZD̲e3Re`l+V%Y
-u.F>n'߲h,n+vW9"n6$\:yt] +k<.Onhs 1l1U11^~S! ӝ3?%0;6LFqלܽyqAL+D!%:6\U>u]* ͳ6ًq<32(MɉtE7[?iqRtzENyjj0ق+s'yMglJnNh2.,{D=l0zr|=mB4ojraؗf}hl6I?BӎO}B:= څ6xՐq/=q)L6:os+~i$w{iaW6t/#Q-wd%ZO폪_QSe <mwQ./Vg }u(/>M7n'3IᗺRKigڭDO![*olX|egrvn;RI"8tVd<rY˝ R6 N18i7g\+dBbr*k-gt2lʝXeηE1;Ekc%i!cõtXJ*
-n _9ogDǞex·)VP>z(5P>o:SP>Ӳr(uʧ%e~SXjgS <ׯf_3 707ɩ~mT߹~sCg*z~P5gR:峝sEzC5\?-gdw3d]s|~epɹ~8OeSj65I6HasuhĹ~F7~ J,l3~S]tK s̯b|_u]oo~Wijй~*rDj}3_CR~[Xz3?O*:,p~:32\?]'~ugkwy|ugk~xY=xxH^<կ"|Ŷiw?|8_y~s,z+~IC<Tz?6Py_UGUD6\?-T?:kābUV0G[j=Oʳڳ6ys̯B}q y|Dղ\?qU1O1S,Wmgޥ<ѩ:Z~LۍىyRW˺gk^Y~ISj=|`H~#3$V}i</>KRT?xs '᥵gYb 9ozntm wQ՟g9l#Xuuj2F$Rgzn1iEUm:dZn%/=e!0rZTKI[J'vܩi}F=ٜaoTڱ˽osх Wr+Կ;M%}S靽H6dw=L$w3_O#mRbwDnldlndv,r38
-x#Kۑid56Y\?>>ΆOzτ{g+ݞ6: :Mfa0]&[{'o칛qO w#6;B]gÎUf1m07=펴nmM0\KONh@+84ߡ8R:GgȠz:HaEVAY;sX{*no G'-˝4r%}_(_s+.x=ZaE[S2ͧMU<zGYm.ݤ+x" ^woyRL q+nw+iYj;j!ϼv]݁{tOUZXϷBjr*un
-$iM#t5xBa+G|~䧿ٯO!(>!]ivc( Njѓ7"\nŻ0""VK9gP,
-{aRHv#!`=^bod)-gonrӷ/ 垾K`:m4,];u_g>w D[䟮{bP>'՝{T$t.6secD[E!dbWZ~"$}Kl;ݻ콝әҭ'sgwӮ$zkr~ř|ΙL[jNཛMD|MnVYލc\eUi@`kmߦB4+<d?"c?Q[̓@_$6v~}4M$uȵ=Ok~n֢Y'hr^([frtLJ^̄z.O] 1h6.=6.ş}c鼵_>!T\\i)NFEшX[T"`RJ-˚ZAٌBC
-XVî]Enc349#'|b+Vi2xzPj<.]cfG<tdSRhG3?@
-P$c/tą Wrsau&"zPONvx(d{ R)!tx6uD~-#
-}=LG2} eYU ь~@W3 crvb7!{O8k^ܒ.?%Wnr:#*
-cBi:ڧV.wGn{&zb}qrnWhfshUR~lT~+mZ&6x|<'RcIgUŊ[:UWd4h/zSz7CD7wh|ngx'SƾUN%v\g|?Fddx>勵bl03l{@D?@K FHIQRSFU}\,Mz!vl!Mݟ?ؓPV}lA 7I3:
-x T9[ oܞmMG}K4 3l%Unq2TNt5E1QH\ Rb:֖Y[O&3͌v@ -yi{IG)!68+Dq즊%a#yr+m]B^Jq gndK_|"O _rg}7Ūtc$#Mt71/it,NoNiOx}xхLt5[TP~vR>F >HԄ[ fH&##%AU?ا*[#m5DT'[H'ltsdʵ!UW>xs6iox"gQ)£B9A*tH(}Z$մ )Ijz<T!a}y[D6@zacjhyvvEF<ԃ~:ͺ"YR^Pi"N$eoty|4S@1ah?dC/;^ַI7w_zp4uf wkTޫ4~', Rwu^'8[y}
-܊oY ǺJ,̄1/6J38ECLcCF=&$,gJm'ILjg6&űgIvVNX"hLqSl=\
-$hq=yT:Q^:{rJ{}t]yUo[\26G^ uq-j;KubW^ Zv(nutP9rמ 3yu#NIܝ |5C:05O]Aژs4-ޓ -"#='v{a?޽(
-aWwIZoHG8&L52ET`yIΓQaPeU"@q6C1ftA9>C[e*HmL2!  C᱃Tx'.Xo66^:m&K^ rsydtup[#j-SCBHr"I(D=Lf0NDb|Ի uz8kY]%Û{ȣh\8xQ( +?'"*p}"I>F:LE>FXMXXf`3 eTJ*MWf<h#_MH]sQN-mvXէz7MqFz˶F QhzzC!u.ʿJ/p>yvlWۭ*?_8Q4(KrA>[ _xt ;R&l.fVI8E[v.x5邦̵X`3r_o?'f}+g`b;~<RrCq0\k1̹Yqxh~YoZ$u#OFT'tP*3vu,vs~TzR1E\"E@fO& !sr\B8[(œErR=&TN<c.I`@b jޝQbӧwMIE=E1bxK5A]w9~U"0
-SV.)i?}OPqoH})f@k%-1ֵO鐢e ᖓ>LqM@δGf].wpg:)󍗼D߻DT*| ʞ-W|doly,:NhVeq]B;ϼ>C ز ]o63l\b&{D&j(GWFHkJg7{##=)& ztCSc̉L~^Jh䠷$8ۃ%#iR
-k
-RnȳDwXRƄ<))h
-6gDcdx'N-yѺ6@: z3"ެ?y ivCX*f{>&D1~Jl
-6_,O7QogUN#^3 Dn/DǮhֻGnnVMOJqqSR1'uH=|Qop(~y6i݇nsӾPURHtfy/@:V5Uqir/ǥT bc|nzzI/_ oLg<-C1'2Tè 1\tѶSpg ri,?d8y+4)Ks錿ۛefKw%=y #?-4~%U/&)my6)H0`c^Zm.+J1cK13y t?#ʻO0Z9㈖UɭTtW|0TFa!;]:9P}C0jf?[^_t5J  !^ːBtSϑQƮNU [G讈't.d*4BnMT0%䷷鹓q1
-/'
-t>Nst>N~uY˻z;DW&K+S;ic
-3j$3@*>9e"DAZN 4d-:ӮO>K5-i?dvCQObU3%bxՓ
-+4Zyz:rP[twKYbE`K^SNr&多 eAY4y$
-Dwɤ1;LQdv'HqOy@TTO28L;޳u6N wX-\tVZc#i앿%CZ0N} y!Kz礒" Fe/!Jn{!K~RLωu,Gg]d>JuFN=T\6D `ѡX펮>&[C3j:v)T0<%Mg<r{uL[ ߨuhvKGS?2i.DCc>6dxl07U PZ- J1j,TzȤ˟?ʊ(,xiA }#Z3]k`3qpae.JJx@ǑQ']lOeNR&w"'qAi[)e6~K×->8,Q6z諑Jv̝KVB
-jYN"yU͛Ԧb!qZjϔʙq[oޭOhC R|E!j(ژWd8$؜P?9TuU駠bRjIYoO0cd4R 0Vt2Z{'o*t2d9@ꝟ |a:Gg+
-| I ?C2Ԥ;l7a-hcT9Vs[>2%̚NtieXFҘ0P^w:}Q2~}/^"ӑ'Ϣhw/99":˝Lͤ :N6
- ӽ>B91RWLB0LQ$Fn !2aa-Iv`R\`dP X$\u e^OD].OEȊhI~o[ҍ@P-ʕ<}K3 iSkYndD" 00Dbal5
-eKBTlp"bB
- I7Z+d:e>70# |x q\֚{De>H=e^jKE=v"Wor @CNW)&2,pDg0$ⵐ褭s3C~.#(4]@CÅힵti=!eMS
-+/jw? L 2jͰXfOld4]Sȣa!뢫B Ԣ.ti亴],Hh(@@ϬDs7\~k NF5Rz"`+w_q+C{J26:3uf"&<+gn =#ܖ`c2d,Z%VK.[r/[j^U &PI *uĂUʣbH*  ַ~f<~m鳱ݭmx+wK<)}9Xcu
-xNgM&>Y:ʥhhH<GB}"a7_R,]`@o(Oý4qL* XC7x:wHify$$$ZM)!y1F94'U\VWbW+!uxDr6r!9[wC֭ҭ]iynKAe㖫mn(g,4%>w44E{EM -2+Rg7ݢ"6WTj6wFsvQA0R+2Zv|Hᰮݢ^wH>gchG':5Eth:{DkY
-J3Zl̃-7Y /vs xJ
-^*WqiӶO"굠{DԢ<mHSYY#^*%NZSR6ҽR\H_5wwn+;گ`ėDR&ax[T/)帘cvr\ 4 dSW4&\ Sgw'ww] 460so w5ֽk=ƒ7bw<qu- ntiv)g&rEv"Wh_܎'+BQAnHpɽudhQW0q#FQݓdtsV_p5wu3,1wݣBxl-?KVS}}:wp.?g+1 Bp`:1TZ%u<tޔZYbu:O~T*|. !i4S(ToCK5v8%e^8Wp0)7V[3ir3СKCY|]^$G2T$]RvbXۃ&UX]}\\[b.Yt{ƲȲ_k[rlDejmMyvr",zvYN.c7hƖi?]jaԟϏòU-RbvVd.3Q:dFNoh능eesU}k:SwUzMGYoA:}{wE^k<܊>!gqLXs:k]_&(Z.?ovKHݛ
-E~+{"_K^،)^XvVJWǎҳ4,4R .G$5Ӧ<,ېzFRْLD"y|:5+iMrgt+0kws.-g=bLw56 y0VX;:7OD<!BVΑ<Z%j9k]L `ltޙ; V;?EZc\c}$ J*M&!TH'X{lhE][d5{S3ilt 猧Rpowc.7t|՚* ȌQOb˓F鈕yO==rb ݧ)-=bRPW њLJw SDR[F辨;='GѼ&Y^T
-X,u
-I(E*_6G:M*|v]#ԡ$ܾiѳvf4uByȹ x"%yWg-Hu؀dRRuRKsò ,?+[R3٪\X݉yau:q1Ңڴ;BK4i$\i{?#7<d#ug+6k/Hx)賤 Uҁ)7iA ѕI!uH7$%ۙc isA {T[忳?Xr7ߑ~hZf1AU?إ*WA-i?֖c=꧶9^
-ͣ{h5ͦ%-^H:/'#ej=!Z_;LSQdam#ߖ]ܸ):4YzԚ6Hi+c,,m }9FQ1FPc6M#^ev?MW#QTpPXrnfɛ<Fr lJWUq+Az=IUF/uYHff$C_Cܨ|uDzF_[zgOF)4p\1;NWʦ{3cb.P`n/K$uoD)=4TF{c|v^; vFM8塯r[D&)b+.-l+x9Dѓ2F6s/1YԗuKS|ڌ}A@1'1S\lqZ3崓K rsyA&E{L/tdcߨ Aᝉ{Xk_*vjG<g1hԯOUh ecf)*ݹ%E ZV[%-e!QS>OUJm*gTe g`*bŰT◲ v3B~IeSʊ
-%؞zBW.&ԼXK.f]ؿOKCztg^I{1,]"^fQM͠u޵qB=&][Is0TDgo8vx_~+/+Q*:^W[F;Bc˩H}u:Fs ԖZ?Pc&UDyXSfunvc %6WVb%az m^4kЉ\WaOuɭ]1
-e%f1
-BK LE-q2,/Q8 ).Hl$X,Am ~(WL5XZz!֙o &R_ ]䋍(5gJw]ۙM/ 'JNTP僬\W+nrRgdz7s䊃SBw({>A^Z,~9GHq+|2$AU&fFG2`=u*IåqA bFP>VH t4[^LGeɢ̛ǞYJZzmr𔥋(Q sFJyNQYLGF<†ۗak=d><=f4NEȀEA@KB7||y4P
- 9F@θ#*4!
-t/NB+w U]ኯgyiMmtelFGYMCѩehESOQ9&u 6aEt!qq/VqBƮgYYex~4I`m!2e/&A[Qz.!˭fWGΓ^y5+~֘TS42F.4Ixq%bKGy-SkfZ ),־Y.%!.5;Sy!TdpXxMTYP[yXfC<'(M!U1JخėR
-ZFnSZQ:ʋ'gNmq ʯ ӳGlٿ+
-4|%֏nbaTTv6FQ(EfRA;RC,:L4J6Kf :¬!i! J4%ih,Y&La R(aR&a^ֆ%j Ct@m+ιV9;M=OAw~{杨etv?RX;lY'͕àY_yNIsvj1 0Sӊ{lgXw̑{h ;jUvtu~2d~Uڨ6JJQkߩ>wG9?jeiBiZ;U,;j#OnMS}= \di]DIu^Jvz9uKәhs}V Ғ9}w'^6 ڦ tѮ0fSC4"2%xp'Fz`25<R_9r{@gtz|##=N}"B~f}Zzt+"~ =$#]R^z-y\Ikoa-c6\?fD)&*S yFj]?A)T1J RC;=M0zCwz:iCAֱ875ҡН^nC;*zCwz08:0zCw&tuRS OɶN%._1P\i:B@9$m @R 3ޢ/գq=K!3fa44y ձf[=֙C8R߈>N$g}x.tPCn)  ⎀|U>i8H?l%(+{&!}C|ehk{Sk+qMv_8z'vl6zɽ<>l[;~ʵљbZ5+ͽ<~"+5/J\!6H7$ m򿩦ȵt/96AS/kѐ%kBصȵMzx""B4%$7EqG?vuu]qz}C
-
-oqZx
-
-oѭ%
- 
-
-
-
-o»
-xV
-
-
- kw$~>Q wGߗ +[WgKf#&m~=z^WySOWoGm͏#pFcG=ơ@vdjnSx>Lo6#jᲁKշQEc+Lo_ϓ&~k^<O9\99& 剏%M;hYFmG<qD#ޡѓX4?O}/o~da3kò?{o㺾Ze4h M!eJQQ(T(CT*)
-P2h̋u]}?CB?kN{-98뺟ڢ85#5OiuJo^|!-)>:2<tF/WǥVfǫ)bԸ7x(9eIS.]! dOdt|Rb,q' M/_PXH{T@nAyJlFAQ|jbܑ7;٣n0QCINzjР3M Q-kdbflЮG''?} ߉Kcn7}[њo߼jnϻv)cQ{wnvu\b9x̨HޠskM55_dcC@h)Yq#O{ߚoR{~)΍s ё׮Fƭ"?z
-h4eakӶ%{5-#1p yJ㒦F]UvޭܧPAnt_ln:UOc9BTi,l\}9qKp/3n'B=|X\w-\r]VXB:bIsU7mʬjF l׬~XbڅwP3oj?BwBJS%ZܷQA9{pOŬi$o=Imʬ.q8.\ֵwU=~RXbvTZ@h^|GElYviطebxֽl6kEi%trn>@e MFͮ|?Ʃ97)軷#;7t:73m9Eg16{8T\FYD
-5j&-ZC2qyMݳ篰U2Mt)_@pDzZcmK0&u Xe-s윽C"%1qO縨<.em{`=&)+,P}b1`ǦQq|)yVͶmgxrXz񃻷mXh3&mq
-cvl0.YϜovö'_X@c)c><й8?ҹ;ֹ[cFi{~b]
-ypY[ۻ q 6ܥ\4;јmݾqt.+s=3ѽ!ȶMQV ) P!(M24Efɴw$ZPWUZxꅔ=A:,636V+9 `GFola토=Q)*,BS#]IO:#rTFʹT322
-꓌f[ڹ<~%/A߼lz~~N`?3'Ws_̶F? }PUB<f_06묜6|e4tû/Ԕݾv!%@_VsrFaºknsO~QVÅlP\ʅkj4xß]Gc m4?vbPUKp9<| U΢ڌ[5`1gBH̺?x>*cx/mg&޳mR(l_Ϣڌ[IJNuᬅv.dozd_ݥ4|nȶQH=kJè&23nK .E ;IȾYXZ7t)#ԞmWfyD59Dܵyng
-~{ل]䘽AKϠ3'*JzFz)<6:q
-[wB05n?d;z
-8js{bD?d#v9qNIe[R xE򢛗]@KQfĠȘLMP(\O3E+":O^u{fdϝڹjqGDEL&(95󗺬߾XJfGͯy0ݫ'U%2NrcDMTYPdyu=c 5Cĥ^+B-pk謍7$ϟ<,ȹd3wDf|ј?s_4*jQKƛpk>LMs{cQ^mkF&*-EFc
-we.zk| jhr~\^u.Kgɑ ,,ǖ](\_Pkz k(V߼'*c=uy.Rd+π=GΣpW! -2W&~L} y\YXɳG'_ạ.hɭd0*j߹~2j
-K}MZfD0!+cNg(,{B̂GdڵԀ+I5#bOg>#rg-HPFIGx:X12se"kODN+/\rr~nn^pdnwDދE.k|נߢFFf́e's@BK7+И ۗjˋXf%';MyPJP'M`jec]EQ^VJLV/$C2Y-f@O$ќ,$25&Cn9|L=gvfTfHV$x T`&*48Ueb`e&3 9u}K/Aa g,3{[̘2f rI-A_5VMopAȴ3_kg>m<X\VUx
-h Cδ7.&fdd#>FQ4}˞hXW^{TTF۹ڊ0csLGV0məyEu Ȍvmٽ'_m3g԰bdllϦ5Kodt#Io"_QDVx2|ZzBdӢY٭5̵uu|naym#0 aճq|VZ詳36S PhP֜<{!Od\WVH֚ Ao_4<s%@/3LNm͂3u$VPw x;ۗĆx,cNShE׶}qiQ"Ze~iYwo^k7%|ܙ $/*^+jG@ı+4x_ A7ϟTeRc<#mE*hwZk$^O:n)nT7K? #릺 xlv3YS^J`KApW<CeW=}=hl.q`LQ&Ӛ $4 PuBnQœ "Xfj;s-Q&?uJk2LV 3Ty-^y#3ӎbDex M5bHZW ߆uxcs} Rbl^h<N`њ8ym Mrᣆ@vlGLSGvnr LbHgf~Sל2oY8^
-Dn/xc3n\8u(t=J`zjdѭY).rZxFq7xB2/OW~GT ORY)/t~ !#>lS(h_M;|*՚sSQSR?cLxvCwY2wdQܣY_,!5S.~$Lv̤a<r`G. )I7"w
-4]mgS+ffT1FUtʯfDHk<PߕƓd{3Ш,8aC(_S~ "w8<vfZ{#KK)~|.+NTO=f\$zQiÎ)WK!u욒[}L' F/A'/ݯnx ~ݙPw#9q{.;Y}x{05ҮݭxCw(GͥSdEXl[/ׅD%e~5\h~P}?I447Ԓ5]~oSTU\}
-<4
-`w.>~I u6Sʣ䴌̗{o?y^ם?85ƎHra2*]Ï^X^ rCugwnt~l5+ey>!Qɗ֋= =*yddMSL)7f͖\4E|ы%x{4DGYV#t)Jy]ӗꞿ[04HKV#T)F7v͖Űfd*~x̰_<moWp)Á#LSB|,jH1 l[
-'ȿ|p+OJ9<2XfBJ*eMiJ ,rk;CMSrqV w ^& >?
-s
-s#M9b|9mpfٽ3(f,6QGSjBluP\0|ؑľ
->}Ed
-Rt17T;zqRCգIΕ[`>L1זJ<i7oz0E`RV5q-p1],gLP6#q_42_BFA)s?izVK諎5'^Rd?<.FA)s
-OEc,['.| 2+s_5T;gjo5r>GRV<}A]d07##ya&[;1lD;l
->⽜Tja%cjeR J[$W[,G^˽C Jc:|2dtFfʰ$0~j=sPB)s L`n!;r@[,1liKN)d/nG%y#]'- ˲aѩ
-aM<rҡ es-6xXv?W{/]OٹHsl[,6a2*syJ_^܄Q#s.fNTle󶛚FwƤ]/nx{/mD0왋\6M*
-eXvE6[vk]e=ͬD ux-fټ9Pʦ#_eSF)L"C:H+Ǐ/|KO9bﲝ'(Dl[&7tǨOb]Qn
-/b4 _1Ry/;p\"TnˣϰBsT…𺱦8l,YY곍e|^Ivm`d"O0l#xbf)G}1۲<{#g%PYxf:Jl1ڲ ˽as,ȗoy_hmyބ59PMڰH󍙙I[v0G%Yms[nvBc-zSTf)r.tpݘ[e-Q"kYb[xZ,Ѝn_KlS[7޴ mY3o&W2 D-ރ,*3lL?&kcQڲhkҫlk+g8|;rZ,e Xb
-ČW1;}s_?TtxM~r,EM~NӴ}TgAN_[Yڲ@V^3\$>_;>GS]8[Hce}+ɇܗUj%~Qډ࣊%@[Hc~Yuѵԣ^E/|j5+_^$07dW ;E$~-j"(|B+t6
-_+-O_9%rs,x5aX@
-—@/`es;՚iSxy&eA`nVM]6;y<UKd_MKnGCOC6u# 9v,xJ,"OX=u[1|1^%;u]mq&G›=B=C^-bl|l2IQb/6lź1gUl"/d>c,Onaƒ3<e~Z
-Do"~X)2De<HiA/<آ ٘VMVb<p޼
-hAo?8ZL=<0U0HQ&69-9VH[kLg"v扽k˵8e:)VD
-z·uOR/޸ 'Ru[>D<0 =
-;-_s6eCh`WtZ=FO~' ND  [LW6{
-љc{>5%;QyJmk?Yd $GRaۿs.hU3kB8Ƶ2>^^| .ۿs0UWS{COU"7gW|T9ZSYP2uQ_lƁowx50-|,xU;4:R._Wz~`OXt>*"jU>sxg+*>_SJ
-T=ڠ2,M/Ե/<e>8spO$׃ʢ
-
-|u.U
-* <ɣ3On\/[GT,;{UpWDᄛHpJ*}lѥ V:mxzaQYya# eQ/g>_,\ѧM+$|3
- Ja-BP\ݹPӈMT&߆ݼ_D*|J=m?@UfNM6dӠ@xCҗԧKsȥ _?|eh&
-_> _Am>—4-|᫵ D٘Sk_[pj`/
-K0~[/ezD|K0~QĠܭGрP+~tي.x| kw#4fQ`'B4d-O/~5 >Ɲ~-B'ǎ:|#,lh̢
-µ C'hJ:}l]e2ܷLesa@h6&W>ۖ?K)L0vׂn>xL_ m&bv:92o!id# m<*PDz9*2C)˖Qџ .esۛnvY4s=G}Ve'e^lٵUK~ް_ز9 mî(|h'2lU2sY'X6(xRwk[ uˆw.Բqʆ]6gJm5l˦S6^]6?r/aK~հ,,F]6$ia-[V G :_NbV"m0lbDZEomwcd({QTq[eP?jߞk_A["1:PCMXvS̖{Iɾ[#3a;YKfZ`|7Fl?qC*es *{~Vs?7MfWf,[l+7={/AeO+f^n6EkBw|~eA.)=셇ؘ(I iaӖݳ`I<2;eܸ_58@ȵ66eԖSp
-P~^aYu4Ș^"׿tgٺE,`)׳bV[O@26{̣PZrΘ4j}!R{+!;ۢ2scwh5<L̺]01nq٫2߲y #`ƨ{W u ًlޑG%_/{Qo]<y p-{ k{32Y9")A1zZ쮍,W[U_rZF넇)}kKo1*nfV0=<L;qG?@1sj#CcqC>F XvOjZrԫ*Uoו_J
-(|EY6_xR՟=Ld
-J87=.e>sfX:m'Sf}J!>+̍41s~{1F}<; yX R~VsFF<و*K%P̽ GmF)b|ux#2
-_Fæ/,FmF콶JʺS
->(57e/^1D6#f.r&kN\نJb<*ob7#c5 /'Ō;3,j)oۈ3ތ V1Y:3ٕ/6U¥`2e巁rT1fFf
-9WxVnR)$;6=͆bfIF-Qg6 <uf#Af6rU^{mYcC7SR̨3Oiz㮘ԫw9 $z}xT[zRrTÏlb8ryw+X}E}es7㵗we~1y8r%9FX#s[YWi`)31[l1js-n='KSTӊ{bw9/2Qk(eR<DRqB'_{Nz52w.tzœAfr?X MV՛e9:0MQgwnt9IIzmdfΙ嵧~(1jdR~}[ݗ͝1v@_~(ҫw+4aWw.>r ,e`rfvD0E/2EEl^c;[_m̈bqZ1gdlj.
-S͗{n;pbBدo^ddvL0әi>Hٝ~}ur%L|9Kl?i,N3uTFoW l(͗{1 ix]WVk }z^B2fk B _f|zxE)jT񭗐xhg>F xvAYgCk@>Cˆ[YItV>Wʳ(F9;#?gw /^7֖g_cuF/FfϞij}᤬[%5 /q
-dpS&Cԓœt
--ݷ>W\d^>!兹OEmt;EKAjX:)*S;0*h/X2|*
-o\3ԚfFIȋ_cf.tudNhʫ(/3.7&(13DA{L,FĦ\:xaTe޳P*cFuL'_zG󔆾W |"rLxNJ:hB'D LWz fD zjPSOä4 fQ2mY"_J`i.'1PlEeZf46#'c]S9T_ lOdM0"C##JkSMyI4(xB2k&3D~ 
-o*PEe 5 ʬkat#;m=ew/y2y߸ ek" ;O~PB"7(Uf<PeWf }qYL4'ou#E/1W@Oav!47<*{19((23ʌ.
-k|K )ok\?ttODnMf13o=nx= έ_?Z ZƩ#x8XrS2|1n7x?͹% IUɝ'v4-e60r s45O2X xɕo_9p0oS-<:|*Z~I!]LP7/En\cga./9"YdrwQ'e߾_YH24gtKFE¼3wYj>CWM" ,?sۦio?~Fe0pmG~j'ؽAmͦMR+1XO,(0Iyu=ceOɺq e׼ugwי^܄u I>lN";̍Wk,3}gߠ1r
-V?5^<~.Orcćey2?Tbꤩl|9qN in[WΞ8sլ)Fܗ'sWdCF*O0sˮg*.܀&?ݽ6߭_?)w# Mn M eF +EܻJړgYXsiMu(OܵoehP>ϯ?s^dFһ2(jۡ /ŜUO]2qk4%߾x4<p%I!{q^d̿&*u^-7 "ە3]$[?ZSZw9-!jQF<6`Wz朐v)6o?trWuĭS[j6
-do@23l+ԜC;}z>^~,Pȯln]Fd D38-ԜE=}Qs4:wr:2T?wv
-CX`9wyHGkqy#|]NF-Yb(DKd<`ɦ \|>v]~9w}j+Ks2ܱkrk=ME!Hp- n4g490YvXyٹ L4P\VDbn+MS2nɢA 7Rrf[ٯY-*.jyDkT9vmq^ja2YؒaJ涫6S6_}umј,^4>F9;#)f_yu5eF/&-9<RFA]gk6rFap
-iאY?;rB@_ 'Rn-BMν=Kp9&gd*,~҈R؇uL5dYW=w%=1f_JZƌBٚ"+2ݜ}g!5tͱ^ 9+ vY!#F )qv[FK^z$^w[3Юy*gMP9{ILwmR{i2JĬN y]l-n@6†l7p (VM.o_>$ft,rG.du~5΃FHrin/xѓiY9w0= iyC]Ui᭫RmX Tn@6]Σp9Omi@l7
-J*a<ES?.+s=udQ!5ܚAQFb!>}>=Ҟ_uтD㚲KcXjo=w*A])rhvdh`_pđ30+QXf޶a'h% BK*iMke%l4jFtF9LԌXH7d
-߾,# 1(Z rtg4;W0xb[wF|)73adf{5qog;+lcF FњrWsk~9;pJaض-tXj7Y$
-g5>dǒYˈЧ 2ν~?0%-i.9<*tX"`yV!߼DD5M 'cW ]# ҃
-3`xs흽C"#sV=~،qsQhUvѸe.X
-i85)clϞ<xPx;R:x x4̨a&fͣ϶q{:RZNYKw,𞃱'Ϝ{A@A3BlS\ĪK޺u.90\ƪƤ!wI{*.#u^фȸ/#M:t P#Ϩة_2~\YZwbZ4>?1ɺ?mKߠa(M/w06EQA7QM TZiS772FV}:huOܐYk$tL̬V`̉KQ~НGAIQ₼kȪgO4Vf͇$!1lQ2rʚ:SZ.q\{#qIg/f]R^3J$u?~RĨ<**SǢnt_lns5qo#؞FI)iL4>fdžC'Rҳ=@BF֍UҸKnwS
-Sǽ㪲;73%'DGvh, ݞ)oKɎS|e+|v?r<17 hQ{5͓=($0_aR/7"&#NO9xG&oW%sh*ɐ!#%(ha^hsC@Ȟ HGuϞ% X<|Km"njxZ[SYzRFj#wmdbtJrhv\c _g2BBYQq0&!9kyw/ %(k_R
-Yx5EY)q2-}&.-kh<wA;OJ=u5ݢeU5OiiO]J_ȥ_D
-7<AE\VRTp+';3 8<,m*'i(9t htgoʸG+65Z9hG3\%׌ԔHlڌޭh;KKK%)\ gO<~@x6u.x!OqP:= nȸ%=VQU[gʌK]<|G9vy7*[X'ϚԤXlD5'5}X],/"pcӺՕeF>wh x&ODex_ θAcD
-ZI}E]r%eՏ MH״شXo89Q;UۈH^Jߗϛak*ݽs3 gSNEܻ38`Z"Stƍ1Y5ՠW7nqAJAEcT+V޸ec`sn޹[taYEU:5kJl6=K4Nu"$.Ry#IҒ{n\ulJb|{‚6Zj%PwhɑUvϝ@вQ!D$V\=|@材r|֕k7`!6<kDj#_z5[":V=Qˊt}~իH\TD޺Hߊ)/]HO=}*>pd୛ֹ8-^hf:}x eԣ2f4n|qC;X$=,Zk`Ȯ1'Sϝϼ|5ƭ;?@bWV74<{9q+*MMWukoN'&;zh@^nN+Z[56Yg(1ϪAӣEAcUPV3y96vk7 hlɤ3i2/g_b#K+*k浵Du${C=QZS]]UUYQ^^-.WpV^KϥbD
-rsv?H$PکϔЃuWRӚKz2oGg7/_P$ǐ֧Sf\ȼ} }
- ˰j~qqQaύwn˽彐q{2>(8lV >klL7ASuh)JbԸC=Zzhړfγspru^e[pخ}QGc'L<}&\ƅY._ɾzy7o1X[7n\vj˗.^8v{<hTA+/]l6ԟ|z8ŔĴSC'Dg?pnTT5 [.Zbs-CwyHt'O9v\ Xu R5sgRϜI9xD#"E=p޴VfϜ2NnĈa#k AGKo#%ed啐ғL9kE˖;:yx"w߁ȃ9{<.ĩĤ䤤S'D=r8u_o7'{,lFU":h
-Cw<=>U5W1r
-㔔UTT5'M44NQQA^Nvh)Q#C-'0i|AGHiJj\ս~L|R{{4},RɎP@ŲJKKIJJHB@ۯoJ_aA·4#55_l <xȐXt:UŲ2dAե%f FiJj5k,6잽zڻwo11~V}*U=;E矰R`P=(I]Dn$8'V]V26,.^,//-zhMrʼnHt:OD_oD] 0!$6QMD%o 0!_xA@TBڂ"DgTuj
-
-|iY/U-5E5%%m/h(j(i _[QYCYQ[SESOC_QSR2_Y֋{cQA2XK~- +4fv+ܖ9;k(ߠLl襢I+
-E^ѿ^cdX#Ҡ mӪ_f=m~@iDUqFwsyxKnK?]\Ez;7y< c\O׶t MkeoCa]UUHT+HhEMuZmT*Sk`љ.0$ Mt\f?w^V7"zh/W"W
-_{R7&+l4U{-=
-l
-
-ۯ
-
-
-
-
-
-
-
-
-
-
-
-
-T
-
-
-p*
-
-
-
-
-
-
-
-EBI H!["$ !"4HysYk} }ܻ%u~%S
-
-
-
--}
-
-
-[B߅n3
-
-5t
-
-0t
-ihjM700d``?UOWGKSCMUe
-#?INVZJB\LDXHo,RҞ?C6T`ȃܤɊ*ȁ4#f3gYXζa`mm5bL3&F teɓdBJF!m`W01)B^AYE]S[Ox,ֶs~g8i"W77_WE ;mlYӍ 5U䑒 JٌVV1|(IB4m;:-\x+Wyy]ooU+=/[uB'G{6-gLJ&I"BX|b>~AJ*fff?R}`p7GDFEEoai!|}n. f3{R6EQ^NZ0r}B@HD\PОjhbD98-Z? ($4,|sԖ;w퉍 `¡C1 쏋ݳk-QBC}Wy/^왦zH 1!T"L!8m.,R!,".%;IQE]{6aVxist̎]{'$>t<3ig3MK=sd񤣇ݵ#&z kVXxf&I"B 6djBt 2asv)Τ8y1rvNn^ՂBWrs/g]<q6̩߷wa!kVy,uEEbmjDWSUI^Nj0)dUC=h,ߐe+-w8t$)tj Y^^|VYy*+n,~ ? SO''9t v׶舍}<ݑVfL< A- aD ^#G *Ե,m-pu_{xԶ]H's
-]QrNͽj7 1߫S]UYQ~ky9/O?s{wn s˂yFjR"ae1vx*s.^7 dS9~LzfVv^AQqɭj
-r]1zUϱ43F$/#!;*bq ԢPY%!#5P/h]8u܂ںOft_~w޿zݻo߼~
-iFb<n_S}F2RO&ݹushbg9B4U'JEȠrZ,&*hZ*â=p82q)'Z1qC/_
-ӧϟ|7W_|Ǐ !Mϟ"'߭]Vr0/9d$QaޞZ0UW,+ wհ6.pY(ΰ_T۰)zGɩ.^ɿvVEU  + ǟo@B Yyes3ޝbdBƙ#cwDo
-psi
-D|8a d] JNVќjlnmTK8v2ҊPE`o|%e|MB IN޾AJ?}~MUyKR% [q4] e Bȅ 9.V*ff_YVYL@EPq?k ^I!|W/>FFTݼw9ccGm Xby63Mj%*?`}q!,&9QQMgkB#bJʫ6<&Pk = >fR'߾*yOyT_{HQ~vfZ=1!뼖Οk9@[UANR!hݣHF6D?UTT{WϤ B/?HRH%H' UW !ϧ8WtX%NvVft'@g1PFȅrQ;%H=E&0Dm0"F>{F$ܬSIn_lomnK W]M
-DvS.f8zmTzVXSԟޢ@5Aw"~k%T#(G޿myلܭ*+.r!-Q뽗8P><ǀhWd{71R.l]=mٛpeUwqU|M  D=*WB5K.e:{KXLC`oWTg ؅ …oP䴋9J*<hxO (8%F0ii~~uٍ {c6tu$CANBD?F'("!w8%=+{=kYAUѮwo^5=i]r-bZrbpi:
- =+fa=V`YUi(ťCkGM2&
-uԱPܫu=/+=p`mf"/-ǫܮ \#x %.-mhf&8b;rq; O[~٠{*Z Ez=jX>[h*Ob~XdaW Vԟa5oǚ ܣN.jj ˢU3Q Ok߸JYlg9}"]`hGMJQ]yO ި}DeAv` iU ^xX[CH Z4wdܮxF`/jR:F38-
-MDy]~=nQeѫ* |hPUm 'I
-ʃE* 4I)iZ;ݲPrkE1˂ 뗄'
-Y2o6nWhiNG?VQ
-dU]ԤyD>xlV~q9Q/ߐ.eAV>7,;ySqw;MWR<.v 0 m,q )b^1Xu? fbh.+<}$.&ljW֦dy? Qda̶w]qkܑS9Eehjn YÃ쌔C{C|=Y1 ̩.o~ DaqZ;!9#~ V>޽n~ZͫYi]z-oC8޾߭]jĨR*(1]W ۶XjV6~w]`}||z.jW[C<QyiO$)"0fTVl]JH\FACvφ='\/y}o?}Qm䃻6y/o=cdi1!dꣳ[/1QYe.KUz3/ ͻ_?xiý7/9JrݪoG.7zRH\w럾xWᙶ/>>OZ?)+r.9aWDMtUnWg+"2~װK*juCFu#Ԥ>}}ծ%WPylw;u)Ɩn"v%¸׀_h {|i J+;6[b7ka `FK {45 J&_\`JU7/>'*{ V:S&J{ ).=Dƕw럽|'Ҥ`7"jʮ]>?&tr'[өjhѧ6 "2,湮
-ܼ;ԅUQA5)/A+<]hFV,mL_ R2 1r\aKѴKj(FjR,ZǓեYg r4B!71LD[$ S[k7n;p"#711
-?0㏯hzp(lҾ!k[!<nȾHMV7h]N^/}{(1abV_7=zPy#\r0?z$,:(xV05muP#d"kaPw[]x*qWO!G+uPk!&id'd˾+qB 7F <0Vڥԣ{V͛e G+u0eVVIxos7*]t_(ԭZluJ:%4 f*kX/X#䅫wꞠ.~߭a_lfmehAdMљn.|W21fQ$n˧uwJ^8#o|+cm%uP2F0q ۅ+os$r Yjt)D³eYgw{,6YK*zsWD=v5o
-C6qSo^[8Wr7K1O/>~,62N cQcn^H>_ZS  /w`Ƿ^=DJSwH̫́5 [35XYY#^<b2ˈOp݆? |,G{;%yHGwH3F-}zf(3ewszwK\B2du@ʸev`SF+4:Q
-ޒ1rΌ9Vo=@h~q`V,Tv5PQZu ^1%鶋Vma1p'۶P:d鈍\dm(-OܜzB /*=yeP̫OF:6X`e 5~9e"ҊZ& WF;)vt_ނX<X:r3Vcl#ɒF AS#F/ilw|>4dՁ- % :a4{ؤshohz=ep?wY'2 g۱Bꆖ#+2> Ft<sȮ0%̧ᵃIN$8m
-?/|ܒ; >q%-qgo2hb}j4N37lב97럷 |P`êgmr3"hV3\DZItO+72gp`t.tƚ%`ŝSZ&VlK8}zçS*~ɃkSGx.=M}4X JtA&ӊ-'n" ֙w//+<y2Yr#dh@ n`|}Ծ |ǐ1hmP:Gwog۳i;3=܈Fh tmޤsW=zAGøMSCMI;C]qKFtBCQ{\Wml~ۿ _?}&aۆUFN` ckUBԝ7 {]Al+NovrGGаK+l;X t+4XfnoNFy~1
- e=s{wq'G-`X;޽xt%akV#8UCS|R
-(4ք>c8E:fNZ2:&rSc'kٞSRC$8`ϹdU_:Ec jSѷp?u_82PICڊ 'b#ڙ*I1Cpcf/"FSf}d#Dtbk9YB*NU>[Mc[]l *踒b
-<%7h 3:^<[mJٸWqb«ɪ>s wɳB ۧ7MŗNZUz|^#O K)-%7ih򬶂Uh"wԍyo܅9?:?|\W@E8Iq0V 婳=&} l?965*0>[A3WZ.^ } V_?ދzOr
-q$*p#
-U9 [=g),#OgSO \<W09.mnݲ6.>a{g^]TPC 3Yd"+2nTw BF{_<^EcSPV`n+#xIF8Z5~a.Ll6rq<q"x w"|
-TP;WhI=%`<3sU[xԪ2::z≽a>ɉw8>jnBw'eN}XA~,졘@s]n4$tl9SJF8Awh#J _bc6Q;AZԦY/ {b] 򏯟Ֆ'n "C, E]sCgʨ-J;ŗR׸( 195 M*F-Bm88[Ѻ4%>{DO@9>#ն;Ѫ4\ׄǥ\*_⨸qx{7miNKyϱ^O*.J*5^ '!.FrAw2~;q_4kMP݆*7TqyBN<3WPBA~y` 5P
-*|Z汝!+#(;r 9}=opx}o[+>? "|<:kUNdłU_~{(A!Tw L&OB{8~g6A=>BlhZhߕ'p^ <w=P=C{0zqbx )QDmal EPԲ!6Q䷥뷠 x-<S!+(׸XȈt3 Eݙ~23C.1ˈ}z\ ǍJF7b?Cs4R9^ub-ǭlTbxXs8vd8'`2G+GGjTzвD֍G>4zuXPuAẒQ|
-~1Ш8r<H*?7|;8j78t uW:~ 9r
-OUМY1ߎR֟ԕRg`<{RU f*H(8ODVhb脳W+ꚠQqU36q2"-<Aͷ4My8YT&*X
-bӐ3.
-QTpq X1a;88F؀/(28~q6" q27v `" 6_{ƉMҜa؅w`<,q6tf.XJy>:3Þ8BJSg;D? T܁qTurލ!t;8eTٸ{cm8ymY>Ζ61qrv5|o+!˻W&DٴadSG[? ~8dG0 8O[TKgs Ĺ[' ]9\{2[ Ulڨi܁79oBbo3TQOʨYo.8bm}] UwH,pLĹqb,H?ʹ*cu<'-sa UOT⓵
-ݛF781N U^>o68S* =ޛι#hzrq-ꤊ5^fԼrO x~ivJU IUNК:o܁z8N
-'pa<mFEۜwP7w<݁/Nx% c<3Qc3Cps[/c*3O溡e"dK0Rq̣xS\A˳֍gnp rhaY8 <_wʭ%.Z˟"^MqY*q.\8JSoN>uwcM,܅u~T\j)Lo|XpmzXmR&5Unp 7<@>6~`!OXkOc,Y66dT#`0WZ?cc/A=/16F0lP{x>=puF6EYLimݲ.17aT5TfOAΘ Ⰺslq[=<4c*n<-HO>Rg<+e=cpL5bzbd#ψCCƹ-ڷ8¥\S䁺.~$ F6ur8P& ۵AP_.@?u.5JS- 6Щ؀U:n__+6d 85-:?5ޣ+6nSoхMp'N,<Ћt<ӫt<֫t6x“Ttх+zοb
-0+{.|2|~oѥއlKt;[w}5:/zN#|^K- ^/ѕew[t;w'-݉;w]]{.|W{FC?Ҍ[t0R'q. ObUpn S؆*m*8] s̡Jeb- *ᤊt/C~yR?Кt'R'UV?nr.^ָÊq.՟hM݌%F?(bt񧽳Ÿb!\b~i0/'b.ę1Np?`2bxzO3-ɶ6!ΌqML=AA~;mnn8qߎcs#iҴ1br3|%Qįp%ۋ ơ:"+q!88_lG(6V8iԡ:ǸDpXŠŽc<hL!*NA=JEmTl?Npٶ888~ sAllg}osPTI;7x` q;}!w!ZvcqN0= Č |֖9y_7 ]}G8XK{BW-@<.Ү "8
-J(Z͸n}S?=h<FA=82q9x Zg hM;f3MUvmqЌ;/*>5jU0Uq
-l|x8ĞNz4*FTԝ9ﻎ_~%=Z6nd$,DE
-:8Ƿ9Wx-w,nG1QG'|Wh smmWJmc'l\ ':ެhO,"x7Jgm p:0#&i].`*1Bf"M>*rWַ\qω׫_Mn?-hwdh Z3!7l݄ݼ|2.| oD;ًc"ﰽYw_di|Fqܑx۵Fmf<0&1=Pݛ٧ou5"TqC4kM)n<zIQJ hSӥժ
-:A_e?GXx1* .TBC.ڸ &́*g^C(]q@]Y&؎o3SGp%Ux! k85@E.8#~
-Zo^fϕF@vwπdqd;G` ^<ms@D_޽hq_9) Vqj"'.U7a"O66^i-SsJ1o!K5Ԯ,sZ9{N,]Cw *?<}PwPLn7KU
-ڦvKξYܮBFMUEObmkx@ ӪG2
-7U]Sh}^iNj–ef:[A^ .^uMdC2w03iw!q_[(Sg9zJ˽E9`nof:T[Aۥ8V@=3ANnǰExy~Ƒ!+,UdE]DqXa)Eyq7 6rX::ߠ[hO-vu;xʝ
-rj#^Tg8·zOYz<ϰئZd'g]G9ǖgH}
-UUm:zSOmX4mb{`lJh zUQU
-;?b
-}TBd3TSŽ*(&6A;84>~^܉>%-MqPK&Uޡfߺ%D0ƚWRb<TWV:cR
-10C 3bS=Z5t0{G@tKDt I+"7 |XX[QxDlR;3b}+_lsh%vW"4/1B_CK?JXJA{\5a٢t0 =dq":p;8[ oDh[6w0qO6^+ >=8yze3f2Փ'b7VOY8Xt^5(:6l;zƝ7h $vJ/Z=,:y *>GJysQtlu$=.x:HDW>mBc9p>cg>oI箖#}S2}|PSsPo9ӵp?9٧:a|}Ծd"a"d"hzt%=.3#Cn9k=:ԍVm?Utr bz| Dufq#4(P2]:d[™h'Gs r}ƩkSGx.=M}neq"J:s|Bw$]Q]sb,_=]t+5'K
-s%4t + F$߰]GܼSO h<}XU|̡!^.8Eq'4:Pt#\_cy5 h- F,-n\IK.Npa6 䆖{\-vmPd[_]͜Gv.g>UENLS F KN0ZD&v:d<s37p?wYh 88Jh@I+c+\(,xPNƱ- Չk Φ(GH+jOu^5k|7tQqlugiL$vp.KǿN.*3c 1O]*A322b7X`e 5SLp"Gs\W߷'&u`юNZhG2L`\9=sh <t2ҁw | %#.2`BkhS :
-M@kyKlܙЁ :gS H6&J2#<Nց\c,aHǥ'>BAK2H^4Ham[qk^2t0d|Fx;2xzQ񒔎;Ne%tأus >C{6u( 1n<Z Ppn\_;}߽zZWeĶ mkx r~S2?kyx˧N `EP75owK={]<k׏o_<6`L;7-˽Y)^ˉIw~WE2<mt*(*.)=Feb fnztrڑ=<MhѪYILRj:gʀȽ^~Z<X 4>o[vҙ] hOxD+os$rQZ<P1pʃڿݫg5
-.:3o|+cet 7EgǺ]QӀV1V>"Vg8XKvLD\VYzr '/\-ɋ7Q(KG*odؿ5g(2(ęlGwmroTxw0[1
-Oe<oWQ}X\tۼY
-}B"<cd5,lٗ}^sn՟}P˧u5
-޳9`oꓥDyG/RVE=z֝/lÜ* bzf~Ʉy:1*/97Om;1l$/Z.Z>|סy7QBuyARK8-tuU&J7::-_qہWlGVy? K]J;{lcme B|m>!o̻h-8Eqφ#g
-Jk7FY]ERDa4=zԅS7r5MMcG%{ tYs]+!|n1
-sFyvŖ0]8=ydbާdhҕVP70/4fR<pC. R!k[OS$)dKZ<h%"cR=2so@շ3U3Qq=\J®Un,pd&>%x,7^BNYeź\ Wh?~|F0Ҏ pkn(# hCLFA]}͆(<*֣g]} T㺚r\vGy/q*/%*VxJɫXڻ\i
-J4>tw}ALRDjwլTTWY. ~>,/<ANI|2<NϹ^^1jWx>ZjRjo]HNL_CR}22X0|h|uaKʿy^>iL80$E4G˜gi׻; ܝ]XZu 4Y.>{hRiwDz/Eaf>ޥP
-*5\+7n;r*3>V.޿~AUiavFʡ=!k=Y]٭0!vRR/ߩ} TrYcmuYQnR1aV-v65PCZ fu8Z=QznoH'f`o>B0Q j]LM:#"}YF(1Ũ]٭偆+SkG[JNtFECV}i/fB37'
-Y2oꊲPa]AW19iW@XLlbJkh/@Ew(/W/'ڻ%5)3C-IRlOd<p5AVQ]+e>d\>Pz%]!l*PpHHI ZꄛdqaDa.ŀUh?j"5A T(? *3-ȲmKFq}9Y&%'!"0?!,ڕǚ>; O[~ ]YI|EEVI Q?%;CXXԮTu8zG~~)~d;B( TYWuz^Ӆ6p5c'+5]#sGȏ뷪@onyn
-"-޼jzP[sZŴX|&w~Y$+QI9Ec-#619bε;?'BZ v,ߴ4@-FAvf1 Gs#]5& (t}LTT| 7W˪>l];*
-
-ԡ?ixPs(RƩc񻷄x\(I
-MF6MBb>a[v={fyO !e0T'?ķ/
-܍V\|xΨ]P]ϛ!c8!L@y{}hԎ}'R_/*_`!_2B(a9&4ѝ _Ql{r2N%ܻ-"5BLaIj
-rT]P.Db9Ums] G
-AR^u/w>RJH'H
-BjaaA Hij ߩ,y-rٓnfŒlfLT,򢵋%o}<9æ-ynU޹i~قJ,YPf IH !&T r/OK9#:,o2ǹt5e$.0}yWBF^Y]p%(!)i/\/)s1RU *- a? ߾r#M .'HŅy2$9#zSL}-Uʼn Lť&*hZqp^郄D=x$Lƅ%ek5<z 9y5| 1 _O/cuݩ&\<z2)QaޞZ0UWF-JLXʹ탼|¸@ԴfBâ9qrk%eUwb'&l5żRnǍ uީuzA^si'ݹushbg9Fz*,&wKF%
-DV^YM)/(t֝ǒO=rN~e5>DV=~yAb^x 9x#da{5Օe7PI\j]1aZ~T-5%,5h\`X>p %7YYbm57Enݹw‘i2s o*Ss䥮H߬Cܿ[sV⢂̌ScM!k<,gB_[MY^VJ\DpQD4.0a;iKy \z] )9x8r~¥으kE7JJoWܮbQYyViɍky9ٗ.OO;rhb=;nۀLpwurk5k4TʓpBi1r8[,.0C  
-QӚ:mLN.K=Vlu9v"ԙs.g_-((dQPp5?/7'rsigN8vPo{:_/OwׅY[j*cC β`*BT5u MgY͙7suA!#ؽ7C;|ԴsMK=}dcG:x n1["7^|aPOK}$YIq!R
-qII
-SԴ3-m~d*o_M[ص'6n J$Ao%??.vϮ۶FGFl
-
-^lBysfa*rbA}bp ^
-brS4uδc0=Wy MQQ[XDGEEFo~>^</]pt#]-҄ X^
-,X|/D$Q(#%FMgZXER]ܖ/\{ڵ~u]kJK\6V3MM 5TY&Ơnb h+d(\"ȈIIkL3nj>f\;{N -&Ao,r^4n+YӍhNQ<QVJB\;
-0P> C%2w 8!B4v;Ux 3YmXX[[Ͷen6cT]m- 5eɓdBdM$L,BxQ RҲ'MVPTM700da`?U9TWS0yDYi) bqcnjfaTtK*d,vDTL|DyEIIYy
-;JJȁD9Yi) b"B#1*:`R Q~le("!))%%%JRR;-c )Lt 3j4 /BamAA
-B Àz(ԓlB?` 
-yfZ5 K@CX<D0 !
-   g%t2!CZY!PfZ
-
-
-
-
-
- 6l#06l(*A(Е:lHQG" P6z(Ç WK_
-|%F7_@P!<
-SԵt (z:ZSĄC_CGQP71b
-2|G e{a _<ce4[9:-rqus[<
-޺٬7JJKo 8JKKn\/:{|U UeExZ]aƉMT7uٸ3żUw U.IܹX}ظQZ_ ~I&s slvaIEU{0@н5U%g _x$1~?P#;0k}?k Θa7cfp:ˁ3>/ { {Ep½eyi(̗<jk]AAG
-]]ܵ'^3U5Uʚڊz׵qMeyiUmO3ݛ\k涹Ğ T?й.<1 t؅2#Xwy]MUuUMuylȘ`?bppT{`kŶ ;042u^x /M#׍78`<l3Z8u_6\?@gw3V]Ymf ?YUZ[m>5ƓcN< f ob}67ؽŵ#|s[()pחVV׻rUV*WUk'U#coVp\skpUTկ߾)DG䉈t/M! H +C}!R)`kf!R)`kf!R[C4[l l2D
-bkf!-hbkf!-hbkf!-hbkf!-hB7h)toB[C4[S[Ix [C$1]kX"$aq2l /aq| Ct <h+Eh}ab`GS.ÅithIhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖L춅PtOp[NPtOp[O3qEA43qBLAE|EGHEM5݁t`tGEt݅xf"t@DDD*t hYr!i*a,3,(:@4/_bE)>bg`PL#!(88$$$Afuy(G30"bexXHpuyGD'$BjdbDrY"yD'&2 ;JOMND&+yN@"2s JJK0?'3-9>:" Y@bӲ*kW^hW76Te%
-3RSE3}~E&dT|;<_zD~<G;/_]QM3F6- S/.%~c'ǯ=i"'z7֗d F?69MlQǨ=W_W3?Hȿ~g}uaFB1I3~V[?ϊ:FĦU~起gH~췿v^[Me8&%k>'~~eâsV5m7/"/|||֦U9abQ4l8q
- JF"{g^$hw~,1D:2Dn9ߢ4HD֔M&{GX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDՔD~S"?xyH;'.D|N/rJψĚ ~9ϼ~?Hwt"F"{|o=o32/>|lH L*[ݱ{x/w7W^|eYNLtg?Ǿ×o{~W?{եL$Ḩ򍧞ѫ|w7}~ꏞ{_F#&YҰyȍw_ͷ7WOt#;77d&8.e!񮢺p>G/_篾O=ཷp"W|DH2%^Xgp==SO?^|G޼ ?|{΍)LvZ"+WƦW6o=}<ط~'<=;NlmO]Q,Y"(<&9qsy='2~?>x;?:~oscYNrLxЊeKH`XTbfQͺ{>C=Vك|+_;>zbk]MQfbTXִƶ~?=myi8KV$b6YEM{p㙳nŻϝ=s {67Ue4z֠kFFq+cGGGjk)I rԁ<$:1=q=w޳׻=wnٺy]cuI^zb1Et1$$IJ)*il^߶}KGt:on[XS^!1jIWTVYSиz^PWSYVfLGfb"̜¢Ҳ镖d%G#@Mw$1ɩ̬2]ɉ1ᡎ " B&Q1q G q1Q#(
-2G ݲZ NQK,mr7ȳ8Y'[DDD)***cg7%=$M)TS)ݔar2MY'?}pg] <l6vR^ߏ6>|OD A!>&s=wA!@D8"(3R\t'H<Y6y<r@t}ggTTR̺w>Q:wDDDDT/(((,,,***...)))---+++//khhh4Yeݺu6lhmmm3m=Ww1camfvӳ||]a"=L_#
-ۆ-tdw{W.!+$1I"O<
-^#g!3E7q4qp_Ttt\%|1w"1[} zbZwtttvvvuuuwwl۶oǎvk<p:4<<<?>?:Fx <.mÖc
-s^juw.Ӟ LϊY-8{Cq\NsXY^?Ŏx6nƫa\ `gUxDFkVDbǽ<uW¼,撘EGo79 f2&vGxcX9AQ"754qF0ymԕ"2,[v;LTKA2k%j}i/ﶈ(^dV,YRO/^eݹ.>xAě)Xmbq(.X$ \q%٢8UB?dagEw;E O+Q3O81N*
-
-*MXX{"<'Nκ_"kgDgɬlq1AGKX~vq'$EEEΖ?͊-*&&jHt8//c'YY>V|Y,kC<z~7ysEg㳲rrrp̵1lyvVK--sVV Y|=AhpeҥǫX;+i!oxo/ ZDYܟ;«j+^aX>ii'Isݯ⣉ZhD>~[V\Isݯb@/
-Dd
-ϏZ:뵭_=X>Q?C틇|JwDκ?/:ӵU%\h,>oyha-S;ybbq*l7|
-ԏhYRY/3Swg"thwEvKs{N}\a-uGtv߭o/dgNY%4n߄3ok YY"5^;+~Ev[5Y WkP,Ig(7LJ~˜yvנL-/5mwb(qJYϋba<opb -,l;5-7[ ߫,.COD
-문hinp4nߎ>o yᔖ%R浳q
-EZ`Aܝ 0oΊ7z297J\
- agxqttX=A3~oP2x%R lLL=03~׌xA0 c ZvV9+. T|3~WwʳDʼvV#.@%N~3ʛAܝ `gfkΊ7zⰦE$m_-nHA0 .>V͖Ί7zPxiW6OV↤Ke([,lI:r%$$`MI
-↤CP_͖8Ś7M˛A08٘%R0@wqB~~!i.PxvHto$%%aMI
-↤CP,o\XӊPXX(nHA0 %ޢ]b;K4[΢\;8I[Hܐ4`(q***%R㵳 QTi8I[Xܐ4`(q*::)YF
-↤CP ]D
-v6""B233E$m
-qC\ ex<;K`jgQ%Fʕ5-'i+TVVb %.C%$$!Y"uBE$m*qC\ eDvH(%.`MI
-↤CP͖Ί7gQ\i8I[Vܐ4`(q*)) )٘
-Ú Is1,:Z\XӢqBCC!i.P2TJJJll,;K`jgQ%
-B
-
-
-E$mFqC\ eT<DPP;K4[uB
- E$m$i.P2TZZ;Kf΢V(WQQִhk֬CPqqqtALY
-*..ƚ Is1222Y"5S;*PURR5-'i+477b %.C\`vh,jrbMI
----↤CP,KgQ"tBP2iݯ^
-֭7$ J\JHH agfk΢V(Wyy9ִ†  ys1 Y,YQ(
-媨 cI[Uܐ4`(q*'''11|͖0:Z\XӢqB[[!i.P2Tnn.;KfjgQ%
-BċyfqC\ e<<Dhh(;K4[uBQ44NVOb %.C糳Dj,EDgQ+kZ4NA0 UPP)UWW5-'i+tttb %.CDjvUBP+kZ4NV7$ J\***JNN |͖0:Z\8Ś Is1Y"5^;BV1ִWXmnqC\ epvh$E֬Y5#nțe(vHKP(
-jjj cI[a۶m↤CP,IgQfi8I[Wܐ4`(q%R6
-Z\---EVV7$ J\*++KKK[r,uAH:+.@hhcqC\ e(vH΢Pʵai8I[a׮]↤CP颳MwD(Wkk+ִh/nHA0 )tV|,
-Z\mmmXӢq!i.P2TEEEFFԯ" ,ʅ3Pi8I[a޽↤CP,2¢>(j%.cMII\ eJ5,uAH:rcM:888cs1Y"e΢DXPс5-'i+8p@ܐ4`(q*33%R ,ى5-'i+<xPܐ4`(q%R6
-Z\]]]XӢq¡C Is1~ջ0yguzm+ b %.CDʼvBPimqC\ 1lmmmvvvtt4:kuA;m60FGG Is1€,\X:aɊBV(Woo/ִhpqC\ 0`{{{]]]NNNLL,uA;'^d%m1qC\ 0 ;K4E}Y,YQ(
-ڱcI
-↤CaXvhݵkִhpqqC\ 0 ;K4΢DXPߏ5-'i+8qBܐ4`( ؘ{Zra- `MI
-'O7$ 
-Ds1
-Z\8ŚN:%nHA0qqq"0cgE$mӧOb ͑ggQ,VY
-BE$mnIܐ4`( ݽf͚xvhf,ִhpqC\ Y9t%’BP`MI
-gϞ7$ 
-455&$$._tAYi8I[ܹs↤CDs4XPuAi8I[[n7$ 
-n۶(11%;5-'i+z↤CDsY%’BPCaMI
-v!i.P_nbMI
-' Is1bg]XGtUBP+kxxkZ4NV뮻 Is1€}}}֭+))IJJ
-a-t>Obvh,bEP+kddhO}Jܐ4`( cǎ 6&''DKg8I[3!i.agγJ%+
-Z\7t'i+|7$ 
-ڵ,%%eʕ; E΢q Is1;K4wS;%+
-Z\G9s 'i+{↤CaTvh|쬤↤,_xvAdEP+kllٳxՓCa͛7WTTfg|cgmfl.;K΢8XP5>>~9l%m/↤Ca{b@?{"{gk+河D~d,XPu[ngxqksEm1€*##Y
-a-Զƒ>(nXggQKV
-BN8q뭷~3,}Mܰ4׳CajNm~Xp7%(,(jr<yn??#<"n;CatvvfffFGG; E`.m7DmY"?P΢>XbɊBV(שS>O?~Ӆ$ 
-<x.+++&&&88%_:㏳DY,VdEP+wu׽+/췾kA0<tPwwwCCCvvvlllHH;K;-.<%Z\xݘhqD ?ED ]?KX:SAY>(YEE--|>vC@L,h!YówϗΞ;wVbvh, Eg[ZZz{{O:u[LJ*
-A0ġ
-A0;K4GS;WPPf͚aM{$iCa@
-p@apvhf#G=i4WVQX Y9t6888666??kpppttk&Is%m 
-P X,/fִMJ*
-A0;K4G]tiPP:vvvݻwxxkqb q(8,`֌=tִc&Is%m %mhh8x ִGLJ*
-A0ġ
-p@a!Y"_;cbM;l4WVQX 0 ;K4]d :][[y澾> kC&Is%m 
-P XD%loo
-A0dgـȬjtv۶m$͕U`( aq@ap"YYwg׮]۠I\I[EaCa@vh.v633{ǎXӊI+o+` YpX"uvvuu屛J*
-A0dgbjg#""\.Weeekkkgggoo/ִ&Is%m 
-P 88YYtvÆ ۶mÚ$iCa@
-Y"eήXbʕ֭koovI\I[Ea1€8;K@ٖ{vwwcM$otm ,K.$:^^^܌uuuaMg4WVQX ".@P YYtk^bq
-vH˗/OKK+++[fMkkkGGִLJ*
-A(
-p@a/`g|!lcc ۱1I+i(,p(`gyljjjii):n:bMm4WVQX ".@aXpX|ta-644KXv$͕U P,\LlXXXJJJIII]]]sss[[ִ&Is%m 8 ఀ%IgkkkZ[[K-H+i(,p(`gY:lٲ5klذuk7I+i(, P8;K@٪*q
-kZQ:Ism ".@P)٤JTE,ݼ6WVQX ".@P YY XӶ$͕U P8ِĂ򺺺&i[MJ*
-A(
-p@a_Hb痕֮Yk &Is%m 8 Dj,]tl^^^iiiuu5@]g7wbq
-,:[RR".cMb4WVQX ".@P;Kfjgrrr+++m6I+i(,p(|%;K:]TTTQQQWW'^jA\I[Ea1
-
-*,,,//E֘$͕U(
-p@a,/lfffAAAYYYuu5ִt
-D\¡
-A(
-p@`gLl@@@LLLrrrfff~~~II ִ&Is%m 8 /dg|1]g\.W^^^qq1ִ&Is%m 8 !Y"^;[TT5mI\I[Ea1
-A(
-٩_dbǧfeecM[b4WVQX ".@P;KfjgWX5mI\I[Ea1
-vV|x6---++ k|bq
- |%;K JHHHMMĚ6$iD\Bgq@CD
-v644Tݓr5I+i(,p()t6...999##kbq
- ِq8==klbq
-ta-vuV#.CaMe4WVQX ".@aXY"5S;lٲ`tVݓ5mI\I[Ea1
-v6((Hݓ5$iD\¡
-$ONNƚ6$iD\¡
-xG\š6$iDbX/bg|ᵳxEÚ6$iY `gLҥKQ(vOLLLBBִ)&Is%m ,2ygK-H+i(,0,CXD%ήX"88X\:CݒLJ*
- ,%R0K,A=2ִt
-DbXY"5^;|rtV݃屛J*
-AܝoZ~ ;K:+6$iD\¡%R&טּ %^jA\I[Ea1
-A,,;K:yu2I+i(,;K^;~G\šVN\I[ag|!ұxu\I[Ea1;K4wu}8,, u0I+i(,/@DKYq2;ݛ,/$u_:vwV\I[EaY"K&7WV dz@;K IgݗKJ*
-AܝF;K yge(-$i
-YY"_;+.CaM+J'oAY"etVԺym%;IgݗP`º,\LK<.+ixu_bgͪJ*
-QwDSZQ+i(8egbV4WVQXwg[Dby,H+o
-MD@1 a!b2;d{/G_t? t=
-]DtODSAݓ}alBL_pt?!tQ="Ʉ1_zgp[Bv5 hRVZy hËf7e/Fڟ-@~k/Rڟ#-@k.R iҵ /fҸz'"Ҹz'b/@sw/F һ 4wzb@/Asq/R һ4G'"@/Asq/R һ4G'"@/1?f@21>ab<_6c~8xOq:ytm<X8ݼPZ oиv?]3a2k7chSo"'EͰl}#kyx9N9=Ymck#?>/sy 77]#ٟef=ncn`ϔAycsgv?4ر?'' """"""""""""""""""""""""""""""""" """""5K/&ݦfjbRep{.1JYi$6RCх{懱'FF+"hR``
-
- dDl;8c 18 'Ǝc Q+BU5B7W \=  OHH4$%%%''$''%DEz#< 8
->3!!)k6nwpѱ'NpԩN~cGG|m]injQ˒\c+VXNJdJǓս$q& 8 1
-+״u[j=k'NVUTVVRb"&gR3r
- ?˃ڗShdBz^imƎ+w :|MPwyǭgo:yоunTnq5g)怱عb Rc#=ZjJT4~/9M5N.[f͚ƆD#(\Мu#dMĹl빵x#̬lX۶W=8r솏Wv빏9g畝mk+.J shc*jp>XW[U]KO2fcuaCǶW@.I,âR2K*״lҦ6֖_h,3cqfWqnl5O=Sst'X?IrV_ּasgO#Μsۻ[*s҉[cK*pNزn= ի.Hpo326%n]{O߮]}WXsgbɾz][˱"5 QfK/jhZ׊8Z77Vl<K*(_ށ?|cȩnݴnM]eI+8]a|Ml4ҭBڷtlm}vH}f]\vs;zzW:穬wUܺqfg&<:1=q]ۖ+z޺e389l|&gϫ[:tӇ?2s˪WMn1K'Źse-mWnƵ E٩񑓧oe ꦶumKN\i68p`po-xsx҉3ŬK+/[ybW]s{Ԯ*Sj=ewNf2s WU74u:kغWī8-,ohٴ8s
-H40D\7A83k6v^KNtiSqڴC><2<4{SSMq1qębniff0 sZrןxT6\~Б'NLi%5jc ɗE񂗐QXgvSvrDNKr:i,sG;6vջϕx3(ÃC 0q*%i-'.-)%=+g];GƎ܉eeQ˸\2qqzr9]CCۍӒK\9m^[[
-2&%eK8ĉ׏U榪K͵{y~sU׌><<`"'r8|%>)53e};vо[ZJ\I;SFNc߱*Ñ##mY7q]!`z/o+IA.5VħWn*u#wniOUT#0k%y>K$]Tt=׌^gMUEYFܧ18VAe
-$C>go-庾&}x׿Gi,G}Ufs+ҹMSN?<m3
-Q ϾO?of`F_<z̭ۖ\zկ̦)'/Mg>Φt4M.O|
-34%*&ԧADw?MI dr!dw?g~K9]z ӊϮ'*z ?+=4_?| |9ͬO螘=*Q9I:>3}=^ʀ]"vPN3:2"^agf1y"{} vSǒskwy?w=iܟʩ V {x%/ӈ=6]?`>vB)5^\N~H{O}믟??3llXWNHp۲`eO,Ԇ&Vw2ws9v)+'[AS޽wk]֠PNν?_ 3ٴIeqλ}zW|h4v+.yJspE>oLN.o߹kjokuAt5%o׭2_tV L~sO˽;>4S&m2_,mn/brҥKb}>tauc{woow{cu!7{k^]O}fW6w_t=4?<|wom.yYՍZ̧Dt޺}޽{wo\[MF7QWc|09ZSgWVQ2mZ췼~KGptzfaiټPb~J} ؕ-vzݳ+*WWz&G`e}skksc}ueyia.NL ُM+n]t&ˤW_֯NSٙٹlʾL`Wx*IOOPixAyQa. wh|j:;;7?77˚ex*Tb^vd"ZUkqڻn%J2E{k:W~/F'e}),jȻMط;)oxo,rv Gx|*:91>6:<4lk7n6tt#vy֎E#cv@_W,]/^fWeS1ɭo2oo`(2<22~|1Tڏ#?pļ|_L"H.^=j ۍ0auoߓ{L[U흲Э%w8U-:7L=u*ힵV{C_$+/[ZeGy)YXS_vеDS޼4ծM UWٟ.bmiY4ygDџn3/ [#,.]_\?œ֚xvQt]k{[d㥢;j;h_]@_goܹhzay>v+/p{/哙_ڐmmc^P]Sᶝ_;#-w9ʕ_p^;vҗf3~ LE;~eX?~:Y%oi+q֫[._zů.v)P~}~ԯN
-
-pʼD~u|Q(Եp6%fBwnj_
-\L5.:@vUFix@#?@iW_\d ..30UIs vMEʝvEEeJjh؁])Qq?@yѮDڟz\hET.>P+"*g( M(ӮE}Z~@v(7R<PVEF}΁]. [aO]1<B0΀v%]I;ho@NI؀ѮmK;2E\ODѮjH;&˾@$ѮjE;eX
-
-[..Ӻިml  u7ׇnJ`]YS[oTN^KJ?1iTזށ`_WkcJIu6y
-hE9$ ߬mlN v4K+zÆD[P$jk
-K\UGr!WY%7teLk싌Gxl|82^MX:$CãcjR?Wx^?${ZFT:D|SVΞ>ձhl*>i
-K".B5uOݰ4QTy%7"CԪPc{x<eS^9fN%STrjUkaK hZ5QWY%sGWym&spi`CաƖ d,12ӱAZyS
-1"1ųV&0zQ 5t*=30?;M\754wGLL͘;[k6tKYzoFN㻀644655qhWW5xfnqia6=5P,g:-,-//-̤\{5<=G^\S7MXήR2=4̙-eL\ZjM_g`x<HegWVVsMܽ? ڑu{MPML]<M
-21d *J7n 5D&gWm\[M5oj
-^rvvaie}csscm1%τy'wW2+jLut) NLFc1;Xg:OU7CmhjviTL|LZ_/D흝᮶f>ZU jQs(RЩDR+ɩ!NMWo8[^5qZF&&+k[;{{;[[!&~-NꞼԘ6Q馈F'&&'2 Mgٙl:3 &*5uMᑩڊkw[=ۻ{o
-
-tun n7fL'괊HS2UT!'EtF*KKK34VS5q]1q]qmoinn-Jepppkw˴Dtlx0mm2fWDJOiUMlԮ~7ALٜ",;`1ѴzƳ .VS륺f%{ dlbl$2809OtތE" 6{^d2Wra*t}}ccskkksDD@(C}]-5;-;wn\[^ɦS56:23ٛCdBUn]]b4VVȈq.iƜ++qֶlo-LGm"mh*5g6^Kk[LT޽+qX]^3 tj:&tDt\h/_&'%+WZ}~*QY?îo(nʹake4y)Ѹ78fU/.ۛ+K 3l6N%㱉QYM v޹Y[QT婨]:(Ӯn%RUGSY6 {ζ03lXwl\ӱсB\Ҧ"JQ)N,/a'qX$,ѝ".}zKd kxQ^SjƧ $S6s`'&[6& K8zkgxtӱ@|MLgַ|G⻶8?k"7X?v\+d޴|[% #cccBcIR\_GiBzK~c\Lff`dt r%wWowT{kɩhdOƵ&rTV-Wj]0:n'X7.!M3f:;oI4luIVU3Y^˥#2TW[[386҉{Ch ^/jd}#ӑZ7D~1QMڨkR䘴I 2d!73#Cՙbo{xږj;=?Oڐy֮D*ͦ&<x455_f޳/ ]0W75.s&AIhLd;Z3K^*UMU5%n'd 7'u&O 8?7#1ly b7wQͤxtbԌJMz2>usÒx%2p2l[ܑ&w_:+K g%Ilm]TcUVL&dttdZP~e`#;ok6۶K@$ۑXYQ]]#oh̀t|T!T$e0WV7ib\Tw9hީ?g+ -ISUMa{SΪbkL/,zpJ4\̥Sv.ah@K.Pka atvfn,+Y[.ˀxomQ oS2`FN
-Y&9K1iR S4@s[]=dkȀxt\S 󉙱%΍l>?fГ^kYfDu/423I5yNQi*/#b͚_ڮt2<lF#v]R#kfYI32'ylr=4VwSm;fZtO 35xtl(dU)4tۻC_#ϸD!cpݲ};G`DIO"@(:91>& 2{\wZedG{{Lutʄ&Uv<eӒW쓡e&S/OʥѱH7=^q4ҴڰFUL2i* h|*F'''L(ݴȰ{bc&e{g: ( e)T۰[E#cv݅fiSX$L\_Q<MMJTIofV\eu"-bR?v{r~-]>B*UԺ婲ظU_+e]_ZI2?m\Ѫd̴8uŨaOalSe4i[o`ߋS'=/4AVYt?F"=-׮j4 vMDe465.t]uY- MDԸu-7MgeRUV[[mjzn\j+1֨{[Cx>#-!5S+isen1nL3eS8UVym캖hB}&Ӳ2+snVp֍Kpo7d\ًcSk_Y7y"\Ye.ͮd{h7b-K{jۘʺB3n5L՟wI|/޼Y®foICa 3l%ށ0v~z7֡pO#4Lʬផst*]7W
-G&K?_u~%4nNӱ͔1*d[Z{ݠhgzDYM)LyffP'Y:BX+^e;o,YUUۖM~a7Cdŷ'~eWJGV͙U;Ú͸ldg5JySCbGG[}z&I0oo-,踺!]r&Ǵq'P$఩Gw滻ݻ,
-F?!Oކi/]];d{{UIBiI<Uu@ZUB-so,s)T揚揶Mv k>QYUYa]][t.LFx- m('}9efcaGcVrXrzg%I].>Z2s|y{ߗ
-um
-_ozk6M]u]UIN}N.vhKYֶ8UVD˗f٦]Yb---y+Dox;ʏ*8DY!|IZv̜-0a-v)
-'/Vpum1m ,edݳ8q\Gas<Ɵbae (meUvolxSvRb:cFHYwɵߒKGr^XIm?6G)PXVzUuXǥ鏗|mŦs JMvG]/ "2XpEUŌe=iauti:-M [e{KC&HaleI uppG[_[kbU@_3tD U#dnqm{쿳-a= 9P-/iITѰ3[{޿mIšJTe:{ITN~?<O.o{ٗtB؄lf\f][w?xt]Lz M\{$ϱspwy{I5'd7q-c
-*щi9j;Xy!vG۸r57ka;w T|ҞtNꓵr]
-[=#JMgDU^,s{<_Z-r>݋.T}Poh rwIN~xckW82KQٌGU;ǞAX㒫lwd<*&$QNTX
-nMyuru!F '94:>11>j3pNKۏ]O}rue"Qݝiq+ުvq2Emv=x^c{]1,){{ީmVka :yFy[#.I!Ɇw:1GaS+MƦƆz uo8)5M&6OzXMG ջ;6]]~d5bN,twU֨F,¡/)a7᮶Kx 
-TW1{\mt^O{}M /|w{wĘ_Y^g0YC;mhvǣSgր8:k('zN[N 2 5 P($gD*kcrCibC饚:3B)6yy"ͺ]m 
-P\n-1LME81JM]5in̳Pn-.F9iq/P|kwo`ppphxt"sh66tl,!  X{ƒ<h<|쑖C{wȟoƦ≤2-o[kKsk#D^u:N>%
-Aua]MƼsT@?4cؔuǝm O )@u꺳Krm:=N\ Yf͞ oq)5 Iw /4-Bt[ .{nnI\-`f80$mܒy;`zã=mMi]8v9=U7ؕ_q"Zl`R3 J\nnzZ‚9}x>۶^on_
-WHJNx7\ݽd #9؅m$~`$q /rYm}s/k![˳^\_e GPA&wӠ г H\6amli봻bDo} 3gr [#mPn0E/epTqN`VmuauwHNL`FuzS] DܩU5 Mj67*Wyǘ堭r9h_`(226KE[$Y<(nǫ'.`pp(2<*ffgsdT.`z\7u E"ɩt:ͤYݦ5|G1{t*JNM 䟾@5aiWǍ1蔉t2.v[ D
-\h,b6)X$]HSy`x<:H&D<H$NS!ACgE&LdF&J\&7+<<1F63Uu%
-GhTp8jZSu*i88#;㜱1TSE:;֖붺׀ofnǯ}ݝ&MFcccC}]m a 9]ckGw_Tζ&fmmȨYu$oȯi5==օL4oVY7n\vkUM]Csk͍u7_1ArY0a EH M--TsSeԷkx:TW $o0Q]"AϹY5 k fě{fV|-Bp!&~* k׮_wCf .K$ZoHCX/ [B˘aLsQU
-ert211΄d,H$d.Kf҉p&;K[X25 ? eӱ\<12Xm:g;Tl&JҙX2J6ϥ͟ųt<'ۘO/K$bd&ƒ霼ݙy ;sX&1-7zfZQ T81NSk_?g?W|g5ct. zP#)gO^>?<cL&1&x!0w_c1GsB6OCE% <xG^{SM#roSG:6{hG=☐By#clc/+;^~vO <G+;3n>;oݧ ?7 Ͽ~NOg;I2TX6mkxBx<k~{?~sfٗ?{ei4߿Z?ٓ{[013Jc'cű_ o.<m&_23_D;<8fM;7
-
-
-v
-
-K!QWeR3x+E%XUui"^{,(Bjyx]!ދ
-!ڇ*B=K !NڙB+vi%B 9^BH}o#nx]:!uNTrAy+ՑCx]!o^<R@yץ6#tx[N!
-}ۅ׹M!)!^g)!e]ufB׬IB}g=uBHx>ksBNNV:!+1.ByxVk
-יC!g׎ !ׇ3NxBy#>NiBy79^'0!xBjKuRBH}ww!]>}>!Y?B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!BHMh׎sX:$(_6T?…
-xYtEB ֶ6YbE3ͭN^V~Aro=]*zG9
-?8<
-Tz%)8 0F{;}pU%KŦщ陙)c|txP;V
-R._Nv~
-1f D:eӺ8!F:8KP
-5
-ñ
-(/5
-@nie }"qz:"wpLm +BD4u5Ϛ Զ@|z4D- ƓL&../`,L#P
-16&Ru8Z6[vV4X{ۀhdR*OM:B hñd6$cjA8& WW{ë6Bm
-SBU @M 䊰X}'j2ڊfvrl@`ޫ7IdV7677֖sX{;:
-HRp@}RT=2+뛗/_ސ~(P}R=4>Ng,fS¶ ͬ
-.}s;
-CH<_Y/ZBijZœ .,,Db̢ސl?Pi&RͭM9x8 Yp4A8Jer7vd4T\
-Y
-Z7
-@VP_Q{fv
-@5C?rd5>vU.e сb]
-K wv]z`2/3Ila
-/? J]=}}ݝm-h Bc3
-ֱhOѭ2ydl|bbBmԯ]ؠGf
-^X۾׻ oQ#'&d׿
-$/35[+`z!z:}Ni&E*i#eggGU[A0o`d\;X"-.k[Mg"{(|u啵uWvͿ/ 8_49
-T
-?9)_[ȼ8'I#G?-=tގ.cIfW}ݫepגo)VEDickT8潰ɃZ٧& ퟁ*
-VϤL5k_Zxk88X8BR wCqW.OTk}ãzpN?\ڔ
-O1’ B ]^O-)r0Pޡ4>*q!Ɣ:ԁ[/[z/:3 EW%V)3r+Y;RI֫e:g|W\}WE
- "5kY7Яi*j-@:diG~kZ (#o9Q!=)~ 2g hOZj@:pcǫ֋5ظ
-jrO$t6~թ =z/c?mYM-ziZ5335iEgݙq}"mG&' ?#DR-Qk>d
-YͤQ@q@s7Q|Uwx?CX$F6+"~en-WN^#j=g^ᗌQOM[ZZq*
-
-@<:朞P4tu^{G5g
-
-=(~/gxP
-+`r"
-_X@_%}$uClSLHOp
-lpEj7WLdl-{AZwWm[PǾ
->=P
-
-T U
-& @S[WTpAMͪ~=ύ 5-<eyhg
-pH32 <rݭזu9#;z&f1 7s k_9_ ]O#`}U㫕jqi[[iM7Ⲁ,. P?oC !}\pVUlLUznOg>[.SX38jL32[kT9A5C/L@}/3u[{r1Xܶ_gZw:[MTK<'IC@kodHE݅*7@œ;{j~8xH-C|ɏZA.
-U~1޾Zptڼ]m3w-QuE]7)Pϳ zC; [YC{:-ʪ|~P"MRMVLo[m |qm
-ZU>3(nVzqͥZ7;^`,U~R϶1҆Q`;ėU~cj֝%*(\۹r{UQ̩7 _Tx aB!B!B!B!B!B!B!B!B!f\}7ߺՋ뾯}]ӼFg<˜dOwſGן>ZsϦ;_ƌGbLXHLƍ2x$ϘB"ɔ_sTLT֌rnH6}t6ʦsƂ:(ID2ɚ>lHĒ0t$x:I&30Oa.1D$=L3/ͤd"xL6ƿT2 '$r2tFO*c,rd,5*GaߢǏ<|ދGHU~񽧏}E/gCGw}ڮ{*y/?RLT^<W[_>M"y.U&KyߋmK帼~߫˸]}>i^y߫:{*9*я9ީbrb.{ _5ֿ~!}K_|ۻWϿw{򡯤4d1a#35nqqcU\0c{Ə&f<nᏇ>3G2r/C§
-f# ӴŽ\ɛ>tO}ߡib,Z,}wz:̡O&c#Jm[z˒ү9~_2#D*.i.F6@ ̤rFC+=xxтwOJoqȋʋl|r}|YÃ8wi3TY( ?7ٍ PM,bfi)HӴ&n#L*)Y;|/I't(U  ƐG83{T\2wx8 ge7hgj]%KK?课_1i{ҠS%92s ppT*wz'(:X>߷, ^ۏrcB$+o߿ueG&
-
-U/hm-!B!B!B!B!uB!r'E 4HoAB!B ySČHΌ'3I#d3x
-i3Mdp$ә{A`TF$siv@X1 }>n'"鄙uE̜,ޏGbd!3l$JR;>uxwQyfH2t<Wsg3I]Lc-_,ͥ*^T.eE.䲸2dG*.`Ʋ[Ì?
-d:R
-[!3CJ>4Kg&JOC?a[d%T(hYDT+l,ͤfKj{Ɋ7tJ!BBes*9ɭ/^S=gJyX;P^lIuUf\*L%sKX?v3*$7RIC\^ٜOL%bD,ݺKH*I?!+Q4VSNu)44lT:'Qپx ^\X֎DC1T(R}B*H+)q3`+CaH&tfV=PzM㟿WIt/bƋxgE(lwQ#ݳJa%oڟ}ybzѪUaJ{HMerZYk??T2kd$i­n.(ݹ $ef.~f}2>lx)uo{NJ7KxR*1*Kjy,%l:Q }2%d w6%j'AJ_m\)lJ7K_\JUOt􊯷j+%+ T9{uT~\.Yx D +DgxTZ7eH*nt=a)D>ʔ_jY+*~zԺR&ZR="V۷oY+Z̴P% |<KIbfJD<2bݤ f3YU۪*xό&2s+"lnͺe}-nU4g5\šyk{x~O~Gb_|߷UD6b<?xa͐ ύx2; lo*߅< doAG6Wwh6d.)3Iգ 2 $#TPR"TfH<L$%y-JTƩ#Ocif
-nDEI$ 3fd3G}Yos O~'B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!zBtVxVYu444x
-J:+N:AsNs^sQӨijj )˃^~=൒
-ӵ8V}EӦitiz5r!7ayPPŧk%^Qd(U֌i&5~MHr!7ayPZ~El^+:]E"FP'KKKKkkkjnjh>|y\M|X؁59E"^-J:+NWxU1 gϞ}w7OO_׿5>'y<%f)*ZIg1PNW.\jRxt}plu-P\T$k%^+-G൒
-ӵ9k%^kR\*ZIgJȫk%B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!Bycz녩V Lj`USjTZ50ժV Lj`USjRB!B!B!B!B!߿u|뻩=ֽ^?]}Eן_{ǭ/>7c~Ȉ~デFp}_qkxv ӈ}O/mCGwf<$DXHH6e)ӌ$Siv_^w_|QKws{7>j7nO>{nfT223Ft|`A5ʖ3޳_?||ӯ5:_wpO= -[?ݿزULB'V*st@6rc/W(/|/zyo]0>O$#D.m,H<Kc$kdJec?@Y#>я&?|7S?.o$X:hB!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!R Rxt%Z[gJYᵶ
-ӕkm^+!g:+NWB
-uVx^k:]듆WCYuzܥq5օ [L9Ay… \ɿ{x,*v.h<%M65-6Zmi|ǁx]xK) wYOO߂koo.,\^ž8'DgO<:+"Z&25Y
- ҋNMWWWGkOӯ  kF41͸fBch&5SE_O >gax=6~HxOm-%bH%$ ~;^ ?zJX?A~ "# %& hORIdIpI|{vHIf$va9 QCC8NVH*<Ԡ>%7QK%5@  CP8_XXD"h4x<H$d*d2l6/iVVVVWW666677w4W?3$0.
-)HC$_ůF:#v?yAsx,-KfCH)0H@K}oz7nܼy֭[o߾sݻw?O>O?>?|ѣGO<y ?3<5{x%)$tS.I[<Ri$gxg/&~)Z~>i>0C )iM$mZ[gK=[VM k(]R+O|߈od8>Iڏv"[CVy+?G~Qj8U^kpl kkϊ_sVI_p(Y^Xƿwloر=?ׄd/+뤆+BRCxs斬%=g_'+U$-p2 ƁxQ$pZUr>[dq6pv4Ť9#guVduPP!RnU{;"OYj!XžZ[gZ{Ɓd0&C)k +W!R_G(ؗkm^kMYI;{U3
-SfepV:2d=:2CR5+=e(rb\X& PTfe*CXEr\8)`MZ:!Zj*Y聾2rjZzpRX&mww75Kip,!EEVI t˦,!UPQДtCeZ4\X醒j8Y:DCEVI
-\8)`MZ:nmmf  *CX+'9B!pR.,ً/RTf/9ZA8 'I;00FR5 MvPZT.jr\X4i@jꨨY((]
-I
-\8)`Mڱjq,}AekQQ$IpR.,uERe&hJ:2(]
-R\8)`Mډ t5KHTԬ B_PZT.jLF. &aCCC===,!QQ}AekQQdYpR.,2CRN/ a-*J|>/NʅAvjjjdd%jjj, *CXE`iiI. &h___SS5KH8iʂ2(]jI
-eA_P.jr\ Ѥ͖uJR8iʂ2(]
-vvvI
-eA_PZT.j7nܐ '‚ljD"uJR8iʂ2(]
-n޼)Nʅ؁d29??OR55ʒNcV [Q֭[r\X4iSf B_PZw۷o˅raML&DYBLr(bWԆT&Z;wIIf5KHuh֢tQ+{\8)`M|>OrjjBʤuQ+IRբIieYz.(h Z'|"NʅiRE֢tQ+OI
->spR.,mllP` ,bWDiZ8)`Md2999yZSETZݕ &5Ki(,t+"X *CXEÇr\X4iS5KHuh֢tQ+x\8)`MڝjpTPbWDTZ'OI
-={&NʕMZjSRYQ+bWD,TZ_~)NʅA|guJRk*JEŋr\jѤf 9%vBA,VĮ`Be*JoF. Ҥqloo/5KHk*CXEo 'IKrJ4 !jEq,TZw}'NʅA͛l fے{֢tQ+~&Nʅ YBNQBM],ıPZT.j?I
-~_ʅravФ}j(f c5Z??ȅravYBNOf#D]"֢tQ+I
-׿ErYB^9vBAVĮ`Y Z-S+w(S%?o~=|ƍL0&j:
-?C.,Rf,VĮ`BewTZʅ2OoѣG7ofЬ 68fEBdKrvX*Y(*VĮ`Be$>l?w/~ɓ[nfjhYB^eE+"XıPŹ e/˧O޾}{iiizz%`=KHm,! -8>KHmyPoLHmu=\?KHmQYSA5y4} NYoL]<G7jpT<7h`,y'$~qQZAXf y%iظ{ӧOҸ(I ,@
--Mr+U
-aE.jK1STGE^phMcuR
- PN=,!'] ŵi\VyP.=,!'IpZjUZ,5K)qѬuliENj=يYjYBXۢqWZ.,!'$֢r*t@QZPP\ENj%0f 9=N}u,UuRTV5Kix)ͺ(IG5u^!f&X:U ;,!4\'5Ҙf 9!jVcE.j`%kVR\'Z15KBVf]:YBNf߱mToEZH%ErB,&poN-D.,5K q׬]e\pE,!$ٖqTvq`YBNȱ+ KN+N BjjXEވ)AHmpz*N BjZ 6Z%N BjZ 6Z%N B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!g;B!B!B!B!B!r
-LaUӮzvô]'r Z I!Y0}ag{l!Fb,C+zaaVHa]?7nNvzӣhG;=Nvzڽ
-ǧY+^˞̟}&o4~ښseЋLVkVrZwd:yc2.;r žg
-s$]ǫʘsel'IAݖU ][xa4c{QP2p3{6z2˓=<{ھ`Aֿ7|koͻN%Us&ġs,Y^& GiYj1Ⱥyx7x\tb<({gqG^o7-/oyU= = ܣ2\ޑ./f9ƎM`AW"DɨCXhlLMxQ.Gj=Ǝp]$n}kcǮd':U}N?]N=z_p=Ma%V]p`&7<&%ow?r kq%l6[SN,kΑioMU]6-0^knn8w'Mط6o
-K7.3Y`Y%vj5ޕ+{ѷƺ\Xr<;IExIr h8n˪ޣ((}GYG{<yј;p\;e$gX=vmx=<{ھ`Aֿ7|koͻNUs&qЎ 4y{Y\ϳ޽LƏrӺbuw~p{o yPd k,oZQ_L~?{,9z GB.w/Y,c˳j]vimTlOO9^ٹ>Vw9eq<( $N';ϋC3XQ}{AZcmks乜}[ںiVðImv/h]/?9<FOyo=}z+ЫNw/]"ISM9}6-o6.t7<>
-0' 0'8ҜM Ѝ_3z+v5<lxӣ\Os兮i
-HԗKI+ri/nvK6# n K1#w}=6AVEeDFF8ykskg=637Ə)X߂orSSɄm||==>LxӃ3ȇߛ7e<~->L6S{.6sIJu֥fbK69or6l붗KTbi(fs}_w=OM}.TANasdliu[^FČx+l{GoNGaͫzr~z\ݼsy̱9Ale1g7G<0].'NCFXC%X%Xm% 'eZfz(-ia ;tFIwCUsŗ]79[|,UѸ
-ID.~i/WҺ߳=}f$'bɴ.]~zrk^;|4Oo6:<Yi8|&E)Ch*.+9,ĕoCL(f8lK+i6=EfH
-f
-z0M`FiK[ͦʙ*aÇZ7184Ӡo3``꾣/gOmm<%Ms(A=6H{'$;o]QQ*9;+,C-.Bx؎}VxG;XZdkM6 עΛ%ErlBFQxw|]-fG0Eyҍئԣ(ĺ] :.kK꜡j.FlId`kj`Ƅ
-> p<ZjgY24=0
-7C\B@!tǛt?T~3^MD5Us(ҷPgUV)!p8
-"XL}zfPAj'^; tR#V E >,9s NTF vԅiǑ6r1(d<<%*tjQ1"GIPu(2LTAЛ=X-ĜHz<@6L.ڛxLY|sl]! M>9fŨs\p
-(3|]&dmdˬPa26<U8
-JniΆLḦY]Y8Bٴ֡**TsfBo ,/~]L , R25R*u9n8t, %~
-=Jɔ>Ta.`phv|jPU~A 
-PpSYF4@4dA҆ uQlHGǮFcVos~tݗs;kLQ6Fq2p ȊOǖ< jJdZgIUaQ#'#63-*4>0 C<OH:ehG(ĔUJ-${<WI EJFkoW,N&Q& ڹD}#aƖ,?Hփn/!;PE(4H3q"
-gbqQQJ9y=jg,&d. @L4cWגxdH7EԢRB E+vo;Y֪yV,/~[W4{FAj.@A'3%w:
-($
-ҵTi$bƆmwo
-r Gt406܈FA,[kADRo$DT;$OYgOV (&Enwvd $},:3Inf@ a 7!3sC`7w 1H.+
-oGh~w7|*.eU!Fd:r'K~ICq$PU#)P
-q
-/GS0 gs
-486 0 0 480 273.6162109 546.6401367 cm
-/Im0 Do
-Q
- endstream endobj 757 0 obj <</BBox[317.616 983.64 715.616 585.64]/Group 915 0 R/Length 59/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ColorSpace<</CS0 788 0 R>>/ExtGState<</GS0 916 0 R>>/ProcSet[/PDF/ImageC/ImageI]/XObject<</Im0 793 0 R>>>>/Subtype/Form>>stream
-q
-/GS0 gs
-398 0 0 398 317.6162109 585.6401367 cm
-/Im0 Do
-Q
- endstream endobj 758 0 obj <</BBox[385.616 858.64 653.616 814.64]/Group 917 0 R/Length 58/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ColorSpace<</CS0 788 0 R>>/ExtGState<</GS0 918 0 R>>/ProcSet[/PDF/ImageC/ImageI]/XObject<</Im0 796 0 R>>>>/Subtype/Form>>stream
-q
-/GS0 gs
-268 0 0 44 385.6162109 814.6401367 cm
-/Im0 Do
-Q
- endstream endobj 759 0 obj <</BBox[382.616 888.64 656.616 585.64]/Group 919 0 R/Length 59/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ColorSpace<</CS0 788 0 R>>/ExtGState<</GS0 920 0 R>>/ProcSet[/PDF/ImageC/ImageI]/XObject<</Im0 799 0 R>>>>/Subtype/Form>>stream
-q
-/GS0 gs
-274 0 0 303 382.6162109 585.6401367 cm
-/Im0 Do
-Q
- endstream endobj 760 0 obj <</BBox[408.0 947.0 704.0 856.0]/Group 921 0 R/Length 42/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ColorSpace<</CS0 788 0 R>>/ExtGState<</GS0 922 0 R>>/ProcSet[/PDF/ImageC/ImageI]/XObject<</Im0 802 0 R>>>>/Subtype/Form>>stream
-q
-/GS0 gs
-296 0 0 91 408 856 cm
-/Im0 Do
-Q
- endstream endobj 761 0 obj <</BBox[246.0 1106.0 718.0 580.0]/Group 923 0 R/Length 43/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ColorSpace<</CS0 788 0 R>>/ExtGState<</GS0 924 0 R>>/ProcSet[/PDF/ImageC/ImageI]/XObject<</Im0 805 0 R>>>>/Subtype/Form>>stream
-q
-/GS0 gs
-472 0 0 526 246 580 cm
-/Im0 Do
-Q
- endstream endobj 762 0 obj <</BBox[283.0 1022.0 796.0 520.0]/Group 925 0 R/Length 43/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ColorSpace<</CS0 788 0 R>>/ExtGState<</GS0 926 0 R>>/ProcSet[/PDF/ImageC/ImageI]/XObject<</Im0 808 0 R>>>>/Subtype/Form>>stream
-q
-/GS0 gs
-513 0 0 502 283 520 cm
-/Im0 Do
-Q
- endstream endobj 925 0 obj <</I false/K false/S/Transparency/Type/Group>> endobj 926 0 obj <</AIS true/BM/Normal/CA 1.0/OP false/OPM 1/SA true/SMask 927 0 R/Type/ExtGState/ca 1.0/op false>> endobj 927 0 obj <</BC 928 0 R/G 929 0 R/S/Luminosity/Type/Mask>> endobj 928 0 obj [0.0 0.0 0.0] endobj 929 0 obj <</BBox[283.0 1022.0 796.0 520.0]/Group 930 0 R/Length 43/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ExtGState<</GS0 747 0 R>>/ProcSet[/PDF/ImageB]/XObject<</Im0 833 0 R>>>>/Subtype/Form>>stream
-q
-/GS0 gs
-513 0 0 502 283 520 cm
-/Im0 Do
-Q
- endstream endobj 930 0 obj <</CS 735 0 R/I false/K false/S/Transparency/Type/Group>> endobj 923 0 obj <</I false/K false/S/Transparency/Type/Group>> endobj 924 0 obj <</AIS true/BM/Normal/CA 1.0/OP false/OPM 1/SA true/SMask 931 0 R/Type/ExtGState/ca 1.0/op false>> endobj 931 0 obj <</BC 932 0 R/G 933 0 R/S/Luminosity/Type/Mask>> endobj 932 0 obj [0.0 0.0 0.0] endobj 933 0 obj <</BBox[246.0 1106.0 718.0 580.0]/Group 934 0 R/Length 43/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ExtGState<</GS0 747 0 R>>/ProcSet[/PDF/ImageB]/XObject<</Im0 839 0 R>>>>/Subtype/Form>>stream
-q
-/GS0 gs
-472 0 0 526 246 580 cm
-/Im0 Do
-Q
- endstream endobj 934 0 obj <</CS 735 0 R/I false/K false/S/Transparency/Type/Group>> endobj 921 0 obj <</I false/K false/S/Transparency/Type/Group>> endobj 922 0 obj <</AIS true/BM/Normal/CA 1.0/OP false/OPM 1/SA true/SMask 935 0 R/Type/ExtGState/ca 1.0/op false>> endobj 935 0 obj <</BC 936 0 R/G 937 0 R/S/Luminosity/Type/Mask>> endobj 936 0 obj [0.0 0.0 0.0] endobj 937 0 obj <</BBox[408.0 947.0 704.0 856.0]/Group 938 0 R/Length 42/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ExtGState<</GS0 747 0 R>>/ProcSet[/PDF/ImageB]/XObject<</Im0 845 0 R>>>>/Subtype/Form>>stream
-q
-/GS0 gs
-296 0 0 91 408 856 cm
-/Im0 Do
-Q
- endstream endobj 938 0 obj <</CS 735 0 R/I false/K false/S/Transparency/Type/Group>> endobj 919 0 obj <</I false/K false/S/Transparency/Type/Group>> endobj 920 0 obj <</AIS true/BM/Normal/CA 1.0/OP false/OPM 1/SA true/SMask 939 0 R/Type/ExtGState/ca 1.0/op false>> endobj 939 0 obj <</BC 940 0 R/G 941 0 R/S/Luminosity/Type/Mask>> endobj 940 0 obj [0.0 0.0 0.0] endobj 941 0 obj <</BBox[382.616 888.64 656.616 585.64]/Group 942 0 R/Length 59/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ExtGState<</GS0 747 0 R>>/ProcSet[/PDF/ImageB]/XObject<</Im0 851 0 R>>>>/Subtype/Form>>stream
-q
-/GS0 gs
-274 0 0 303 382.6162109 585.6401367 cm
-/Im0 Do
-Q
- endstream endobj 942 0 obj <</CS 735 0 R/I false/K false/S/Transparency/Type/Group>> endobj 917 0 obj <</I false/K false/S/Transparency/Type/Group>> endobj 918 0 obj <</AIS true/BM/Normal/CA 1.0/OP false/OPM 1/SA true/SMask 943 0 R/Type/ExtGState/ca 1.0/op false>> endobj 943 0 obj <</BC 944 0 R/G 945 0 R/S/Luminosity/Type/Mask>> endobj 944 0 obj [0.0 0.0 0.0] endobj 945 0 obj <</BBox[385.616 858.64 653.616 814.64]/Group 946 0 R/Length 58/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ExtGState<</GS0 747 0 R>>/ProcSet[/PDF/ImageB]/XObject<</Im0 857 0 R>>>>/Subtype/Form>>stream
-q
-/GS0 gs
-268 0 0 44 385.6162109 814.6401367 cm
-/Im0 Do
-Q
- endstream endobj 946 0 obj <</CS 735 0 R/I false/K false/S/Transparency/Type/Group>> endobj 915 0 obj <</I false/K false/S/Transparency/Type/Group>> endobj 916 0 obj <</AIS true/BM/Normal/CA 1.0/OP false/OPM 1/SA true/SMask 947 0 R/Type/ExtGState/ca 1.0/op false>> endobj 947 0 obj <</BC 948 0 R/G 949 0 R/S/Luminosity/Type/Mask>> endobj 948 0 obj [0.0 0.0 0.0] endobj 949 0 obj <</BBox[317.616 983.64 715.616 585.64]/Group 950 0 R/Length 59/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ExtGState<</GS0 747 0 R>>/ProcSet[/PDF/ImageB]/XObject<</Im0 863 0 R>>>>/Subtype/Form>>stream
-q
-/GS0 gs
-398 0 0 398 317.6162109 585.6401367 cm
-/Im0 Do
-Q
- endstream endobj 950 0 obj <</CS 735 0 R/I false/K false/S/Transparency/Type/Group>> endobj 913 0 obj <</I false/K false/S/Transparency/Type/Group>> endobj 914 0 obj <</AIS true/BM/Normal/CA 1.0/OP false/OPM 1/SA true/SMask 951 0 R/Type/ExtGState/ca 1.0/op false>> endobj 951 0 obj <</BC 952 0 R/G 953 0 R/S/Luminosity/Type/Mask>> endobj 952 0 obj [0.0 0.0 0.0] endobj 953 0 obj <</BBox[273.616 1026.64 759.616 546.64]/Group 954 0 R/Length 59/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ExtGState<</GS0 747 0 R>>/ProcSet[/PDF/ImageB]/XObject<</Im0 869 0 R>>>>/Subtype/Form>>stream
-q
-/GS0 gs
-486 0 0 480 273.6162109 546.6401367 cm
-/Im0 Do
-Q
- endstream endobj 954 0 obj <</CS 735 0 R/I false/K false/S/Transparency/Type/Group>> endobj 746 0 obj <</AIS false/BM/Normal/CA 1.0/OP false/OPM 1/SA true/SMask 955 0 R/Type/ExtGState/ca 1.0/op false>> endobj 748 0 obj <</AIS false/BM/Normal/CA 1.0/OP false/OPM 1/SA true/SMask 956 0 R/Type/ExtGState/ca 1.0/op false>> endobj 749 0 obj <</AIS false/BM/Normal/CA 1.0/OP false/OPM 1/SA true/SMask 957 0 R/Type/ExtGState/ca 1.0/op false>> endobj 750 0 obj <</AIS false/BM/Normal/CA 1.0/OP false/OPM 1/SA true/SMask 958 0 R/Type/ExtGState/ca 1.0/op false>> endobj 751 0 obj <</AIS false/BM/Normal/CA 1.0/OP false/OPM 1/SA true/SMask 959 0 R/Type/ExtGState/ca 1.0/op false>> endobj 959 0 obj <</G 960 0 R/S/Luminosity/Type/Mask>> endobj 960 0 obj <</BBox[-32768.0 32767.0 32767.0 -32768.0]/Group 961 0 R/Length 84/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ExtGState<</GS0 744 0 R>>/Shading<</Sh0 892 0 R>>>>/Subtype/Form>>stream
-q
-0 g
-/GS0 gs
-15.8993082 0 0 -16.1025677 1392.8847656 296.171875 cm
-BX /Sh0 sh EX Q
- endstream endobj 961 0 obj <</CS/DeviceGray/I false/K false/S/Transparency/Type/Group>> endobj 958 0 obj <</G 962 0 R/S/Luminosity/Type/Mask>> endobj 962 0 obj <</BBox[-32768.0 32767.0 32767.0 -32768.0]/Group 963 0 R/Length 85/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ExtGState<</GS0 744 0 R>>/Shading<</Sh0 892 0 R>>>>/Subtype/Form>>stream
-q
-0 g
-/GS0 gs
-11.9217148 0 0 -12.0797682 1392.7294922 335.4882812 cm
-BX /Sh0 sh EX Q
- endstream endobj 963 0 obj <</CS/DeviceGray/I false/K false/S/Transparency/Type/Group>> endobj 957 0 obj <</G 964 0 R/S/Luminosity/Type/Mask>> endobj 964 0 obj <</BBox[-32768.0 32767.0 32767.0 -32768.0]/Group 965 0 R/Length 87/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ExtGState<</GS0 744 0 R>>/Shading<</Sh0 892 0 R>>>>/Subtype/Form>>stream
-q
-0 g
-/GS0 gs
-225.9361572 0 0 -225.9361572 1389.9453125 728.7958984 cm
-BX /Sh0 sh EX Q
- endstream endobj 965 0 obj <</CS/DeviceGray/I false/K false/S/Transparency/Type/Group>> endobj 956 0 obj <</G 966 0 R/S/Luminosity/Type/Mask>> endobj 966 0 obj <</BBox[-32768.0 32767.0 32767.0 -32768.0]/Group 967 0 R/Length 83/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ExtGState<</GS0 744 0 R>>/Shading<</Sh0 892 0 R>>>>/Subtype/Form>>stream
-q
-0 g
-/GS0 gs
-7.9551892 0 0 -8.0455885 1392.7294922 366.4384766 cm
-BX /Sh0 sh EX Q
- endstream endobj 967 0 obj <</CS/DeviceGray/I false/K false/S/Transparency/Type/Group>> endobj 955 0 obj <</G 968 0 R/S/Luminosity/Type/Mask>> endobj 968 0 obj <</BBox[-32768.0 32767.0 32767.0 -32768.0]/Group 969 0 R/Length 84/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ExtGState<</GS0 744 0 R>>/Shading<</Sh0 892 0 R>>>>/Subtype/Form>>stream
-q
-0 g
-/GS0 gs
-225.9359131 0 0 -225.9359131 509.96875 794.0385742 cm
-BX /Sh0 sh EX Q
- endstream endobj 969 0 obj <</CS/DeviceGray/I false/K false/S/Transparency/Type/Group>> endobj 912 0 obj [/ICCBased 819 0 R] endobj 5 0 obj <</Intent 154 0 R/Name(Calque 1)/Type/OCG/Usage 155 0 R>> endobj 248 0 obj <</Intent 395 0 R/Name(Calque 1)/Type/OCG/Usage 396 0 R>> endobj 489 0 obj <</Intent 636 0 R/Name(Calque 1)/Type/OCG/Usage 637 0 R>> endobj 636 0 obj [/View/Design] endobj 637 0 obj <</CreatorInfo<</Creator(Adobe Illustrator 16.0)/Subtype/Artwork>>>> endobj 395 0 obj [/View/Design] endobj 396 0 obj <</CreatorInfo<</Creator(Adobe Illustrator 16.0)/Subtype/Artwork>>>> endobj 154 0 obj [/View/Design] endobj 155 0 obj <</CreatorInfo<</Creator(Adobe Illustrator 16.0)/Subtype/Artwork>>>> endobj 731 0 obj [730 0 R] endobj 970 0 obj <</CreationDate(D:20140916123631+02'00')/Creator(Adobe Illustrator CS6 \(Macintosh\))/ModDate(D:20140918115258+02'00')/Producer(Adobe PDF library 10.01)/Title(logotalerv2)>> endobj xref 0 971 0000000004 65535 f
-0000000016 00000 n
-0000000194 00000 n
-0000050669 00000 n
-0000000006 00000 f
-0000539738 00000 n
-0000000009 00000 f
-0000050726 00000 n
-0000051599 00000 n
-0000000010 00000 f
-0000000011 00000 f
-0000000012 00000 f
-0000000013 00000 f
-0000000014 00000 f
-0000000015 00000 f
-0000000016 00000 f
-0000000017 00000 f
-0000000018 00000 f
-0000000019 00000 f
-0000000020 00000 f
-0000000021 00000 f
-0000000022 00000 f
-0000000023 00000 f
-0000000024 00000 f
-0000000025 00000 f
-0000000026 00000 f
-0000000027 00000 f
-0000000028 00000 f
-0000000029 00000 f
-0000000030 00000 f
-0000000031 00000 f
-0000000032 00000 f
-0000000033 00000 f
-0000000034 00000 f
-0000000035 00000 f
-0000000036 00000 f
-0000000037 00000 f
-0000000038 00000 f
-0000000039 00000 f
-0000000040 00000 f
-0000000041 00000 f
-0000000042 00000 f
-0000000043 00000 f
-0000000044 00000 f
-0000000045 00000 f
-0000000046 00000 f
-0000000047 00000 f
-0000000048 00000 f
-0000000049 00000 f
-0000000050 00000 f
-0000000051 00000 f
-0000000052 00000 f
-0000000053 00000 f
-0000000054 00000 f
-0000000055 00000 f
-0000000056 00000 f
-0000000057 00000 f
-0000000058 00000 f
-0000000059 00000 f
-0000000060 00000 f
-0000000061 00000 f
-0000000062 00000 f
-0000000063 00000 f
-0000000064 00000 f
-0000000065 00000 f
-0000000066 00000 f
-0000000067 00000 f
-0000000068 00000 f
-0000000069 00000 f
-0000000070 00000 f
-0000000071 00000 f
-0000000072 00000 f
-0000000073 00000 f
-0000000074 00000 f
-0000000075 00000 f
-0000000076 00000 f
-0000000077 00000 f
-0000000078 00000 f
-0000000079 00000 f
-0000000080 00000 f
-0000000081 00000 f
-0000000082 00000 f
-0000000083 00000 f
-0000000084 00000 f
-0000000085 00000 f
-0000000086 00000 f
-0000000087 00000 f
-0000000088 00000 f
-0000000089 00000 f
-0000000090 00000 f
-0000000091 00000 f
-0000000092 00000 f
-0000000093 00000 f
-0000000094 00000 f
-0000000095 00000 f
-0000000096 00000 f
-0000000097 00000 f
-0000000098 00000 f
-0000000099 00000 f
-0000000100 00000 f
-0000000101 00000 f
-0000000102 00000 f
-0000000103 00000 f
-0000000104 00000 f
-0000000105 00000 f
-0000000106 00000 f
-0000000107 00000 f
-0000000108 00000 f
-0000000109 00000 f
-0000000110 00000 f
-0000000111 00000 f
-0000000112 00000 f
-0000000113 00000 f
-0000000114 00000 f
-0000000115 00000 f
-0000000116 00000 f
-0000000117 00000 f
-0000000118 00000 f
-0000000119 00000 f
-0000000120 00000 f
-0000000121 00000 f
-0000000122 00000 f
-0000000123 00000 f
-0000000124 00000 f
-0000000125 00000 f
-0000000126 00000 f
-0000000127 00000 f
-0000000128 00000 f
-0000000129 00000 f
-0000000130 00000 f
-0000000131 00000 f
-0000000132 00000 f
-0000000133 00000 f
-0000000134 00000 f
-0000000135 00000 f
-0000000136 00000 f
-0000000137 00000 f
-0000000138 00000 f
-0000000139 00000 f
-0000000140 00000 f
-0000000141 00000 f
-0000000142 00000 f
-0000000143 00000 f
-0000000144 00000 f
-0000000145 00000 f
-0000000146 00000 f
-0000000147 00000 f
-0000000148 00000 f
-0000000149 00000 f
-0000000150 00000 f
-0000000151 00000 f
-0000000152 00000 f
-0000000153 00000 f
-0000000156 00000 f
-0000540197 00000 n
-0000540229 00000 n
-0000000157 00000 f
-0000000158 00000 f
-0000000159 00000 f
-0000000160 00000 f
-0000000161 00000 f
-0000000162 00000 f
-0000000163 00000 f
-0000000164 00000 f
-0000000165 00000 f
-0000000166 00000 f
-0000000167 00000 f
-0000000168 00000 f
-0000000169 00000 f
-0000000170 00000 f
-0000000171 00000 f
-0000000172 00000 f
-0000000173 00000 f
-0000000174 00000 f
-0000000175 00000 f
-0000000176 00000 f
-0000000177 00000 f
-0000000178 00000 f
-0000000179 00000 f
-0000000180 00000 f
-0000000181 00000 f
-0000000182 00000 f
-0000000183 00000 f
-0000000184 00000 f
-0000000185 00000 f
-0000000186 00000 f
-0000000187 00000 f
-0000000188 00000 f
-0000000189 00000 f
-0000000190 00000 f
-0000000191 00000 f
-0000000192 00000 f
-0000000193 00000 f
-0000000194 00000 f
-0000000195 00000 f
-0000000196 00000 f
-0000000197 00000 f
-0000000198 00000 f
-0000000199 00000 f
-0000000200 00000 f
-0000000201 00000 f
-0000000202 00000 f
-0000000203 00000 f
-0000000204 00000 f
-0000000205 00000 f
-0000000206 00000 f
-0000000207 00000 f
-0000000208 00000 f
-0000000209 00000 f
-0000000210 00000 f
-0000000211 00000 f
-0000000212 00000 f
-0000000213 00000 f
-0000000214 00000 f
-0000000215 00000 f
-0000000216 00000 f
-0000000217 00000 f
-0000000218 00000 f
-0000000219 00000 f
-0000000220 00000 f
-0000000221 00000 f
-0000000222 00000 f
-0000000223 00000 f
-0000000224 00000 f
-0000000225 00000 f
-0000000226 00000 f
-0000000227 00000 f
-0000000228 00000 f
-0000000229 00000 f
-0000000230 00000 f
-0000000231 00000 f
-0000000232 00000 f
-0000000233 00000 f
-0000000234 00000 f
-0000000235 00000 f
-0000000236 00000 f
-0000000237 00000 f
-0000000238 00000 f
-0000000239 00000 f
-0000000240 00000 f
-0000000241 00000 f
-0000000242 00000 f
-0000000243 00000 f
-0000000244 00000 f
-0000000245 00000 f
-0000000246 00000 f
-0000000247 00000 f
-0000000249 00000 f
-0000539811 00000 n
-0000000250 00000 f
-0000000251 00000 f
-0000000252 00000 f
-0000000253 00000 f
-0000000254 00000 f
-0000000255 00000 f
-0000000256 00000 f
-0000000257 00000 f
-0000000258 00000 f
-0000000259 00000 f
-0000000260 00000 f
-0000000261 00000 f
-0000000262 00000 f
-0000000263 00000 f
-0000000264 00000 f
-0000000265 00000 f
-0000000266 00000 f
-0000000267 00000 f
-0000000268 00000 f
-0000000269 00000 f
-0000000270 00000 f
-0000000271 00000 f
-0000000272 00000 f
-0000000273 00000 f
-0000000274 00000 f
-0000000275 00000 f
-0000000276 00000 f
-0000000277 00000 f
-0000000278 00000 f
-0000000279 00000 f
-0000000280 00000 f
-0000000281 00000 f
-0000000282 00000 f
-0000000283 00000 f
-0000000284 00000 f
-0000000285 00000 f
-0000000286 00000 f
-0000000287 00000 f
-0000000288 00000 f
-0000000289 00000 f
-0000000290 00000 f
-0000000291 00000 f
-0000000292 00000 f
-0000000293 00000 f
-0000000294 00000 f
-0000000295 00000 f
-0000000296 00000 f
-0000000297 00000 f
-0000000298 00000 f
-0000000299 00000 f
-0000000300 00000 f
-0000000301 00000 f
-0000000302 00000 f
-0000000303 00000 f
-0000000304 00000 f
-0000000305 00000 f
-0000000306 00000 f
-0000000307 00000 f
-0000000308 00000 f
-0000000309 00000 f
-0000000310 00000 f
-0000000311 00000 f
-0000000312 00000 f
-0000000313 00000 f
-0000000314 00000 f
-0000000315 00000 f
-0000000316 00000 f
-0000000317 00000 f
-0000000318 00000 f
-0000000319 00000 f
-0000000320 00000 f
-0000000321 00000 f
-0000000322 00000 f
-0000000323 00000 f
-0000000324 00000 f
-0000000325 00000 f
-0000000326 00000 f
-0000000327 00000 f
-0000000328 00000 f
-0000000329 00000 f
-0000000330 00000 f
-0000000331 00000 f
-0000000332 00000 f
-0000000333 00000 f
-0000000334 00000 f
-0000000335 00000 f
-0000000336 00000 f
-0000000337 00000 f
-0000000338 00000 f
-0000000339 00000 f
-0000000340 00000 f
-0000000341 00000 f
-0000000342 00000 f
-0000000343 00000 f
-0000000344 00000 f
-0000000345 00000 f
-0000000346 00000 f
-0000000347 00000 f
-0000000348 00000 f
-0000000349 00000 f
-0000000350 00000 f
-0000000351 00000 f
-0000000352 00000 f
-0000000353 00000 f
-0000000354 00000 f
-0000000355 00000 f
-0000000356 00000 f
-0000000357 00000 f
-0000000358 00000 f
-0000000359 00000 f
-0000000360 00000 f
-0000000361 00000 f
-0000000362 00000 f
-0000000363 00000 f
-0000000364 00000 f
-0000000365 00000 f
-0000000366 00000 f
-0000000367 00000 f
-0000000368 00000 f
-0000000369 00000 f
-0000000370 00000 f
-0000000371 00000 f
-0000000372 00000 f
-0000000373 00000 f
-0000000374 00000 f
-0000000375 00000 f
-0000000376 00000 f
-0000000377 00000 f
-0000000378 00000 f
-0000000379 00000 f
-0000000380 00000 f
-0000000381 00000 f
-0000000382 00000 f
-0000000383 00000 f
-0000000384 00000 f
-0000000385 00000 f
-0000000386 00000 f
-0000000387 00000 f
-0000000388 00000 f
-0000000389 00000 f
-0000000390 00000 f
-0000000391 00000 f
-0000000392 00000 f
-0000000393 00000 f
-0000000394 00000 f
-0000000397 00000 f
-0000540079 00000 n
-0000540111 00000 n
-0000000398 00000 f
-0000000399 00000 f
-0000000400 00000 f
-0000000401 00000 f
-0000000402 00000 f
-0000000403 00000 f
-0000000404 00000 f
-0000000405 00000 f
-0000000406 00000 f
-0000000407 00000 f
-0000000408 00000 f
-0000000409 00000 f
-0000000410 00000 f
-0000000411 00000 f
-0000000412 00000 f
-0000000413 00000 f
-0000000414 00000 f
-0000000415 00000 f
-0000000416 00000 f
-0000000417 00000 f
-0000000418 00000 f
-0000000419 00000 f
-0000000420 00000 f
-0000000421 00000 f
-0000000422 00000 f
-0000000423 00000 f
-0000000424 00000 f
-0000000425 00000 f
-0000000426 00000 f
-0000000427 00000 f
-0000000428 00000 f
-0000000429 00000 f
-0000000430 00000 f
-0000000431 00000 f
-0000000432 00000 f
-0000000433 00000 f
-0000000434 00000 f
-0000000435 00000 f
-0000000436 00000 f
-0000000437 00000 f
-0000000438 00000 f
-0000000439 00000 f
-0000000440 00000 f
-0000000441 00000 f
-0000000442 00000 f
-0000000443 00000 f
-0000000444 00000 f
-0000000445 00000 f
-0000000446 00000 f
-0000000447 00000 f
-0000000448 00000 f
-0000000449 00000 f
-0000000450 00000 f
-0000000451 00000 f
-0000000452 00000 f
-0000000453 00000 f
-0000000454 00000 f
-0000000455 00000 f
-0000000456 00000 f
-0000000457 00000 f
-0000000458 00000 f
-0000000459 00000 f
-0000000460 00000 f
-0000000461 00000 f
-0000000462 00000 f
-0000000463 00000 f
-0000000464 00000 f
-0000000465 00000 f
-0000000466 00000 f
-0000000467 00000 f
-0000000468 00000 f
-0000000469 00000 f
-0000000470 00000 f
-0000000471 00000 f
-0000000472 00000 f
-0000000473 00000 f
-0000000474 00000 f
-0000000475 00000 f
-0000000476 00000 f
-0000000477 00000 f
-0000000478 00000 f
-0000000479 00000 f
-0000000480 00000 f
-0000000481 00000 f
-0000000482 00000 f
-0000000483 00000 f
-0000000484 00000 f
-0000000485 00000 f
-0000000486 00000 f
-0000000487 00000 f
-0000000488 00000 f
-0000000000 00000 f
-0000539886 00000 n
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000539961 00000 n
-0000539993 00000 n
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000000000 00000 f
-0000255776 00000 n
-0000540315 00000 n
-0000526925 00000 n
-0000530281 00000 n
-0000272389 00000 n
-0000072965 00000 n
-0000080180 00000 n
-0000077135 00000 n
-0000078917 00000 n
-0000078454 00000 n
-0000076711 00000 n
-0000076244 00000 n
-0000075807 00000 n
-0000072621 00000 n
-0000268801 00000 n
-0000268915 00000 n
-0000536963 00000 n
-0000100986 00000 n
-0000537080 00000 n
-0000537197 00000 n
-0000537314 00000 n
-0000537431 00000 n
-0000255969 00000 n
-0000257133 00000 n
-0000257476 00000 n
-0000254768 00000 n
-0000530345 00000 n
-0000530669 00000 n
-0000530992 00000 n
-0000531314 00000 n
-0000531637 00000 n
-0000531937 00000 n
-0000532239 00000 n
-0000058286 00000 n
-0000058829 00000 n
-0000064795 00000 n
-0000065059 00000 n
-0000065376 00000 n
-0000071367 00000 n
-0000071636 00000 n
-0000071964 00000 n
-0000072239 00000 n
-0000052478 00000 n
-0000055983 00000 n
-0000269032 00000 n
-0000269149 00000 n
-0000269266 00000 n
-0000269383 00000 n
-0000269500 00000 n
-0000056047 00000 n
-0000056374 00000 n
-0000056701 00000 n
-0000057027 00000 n
-0000057354 00000 n
-0000057664 00000 n
-0000057975 00000 n
-0000526888 00000 n
-0000199803 00000 n
-0000081996 00000 n
-0000228123 00000 n
-0000199867 00000 n
-0000155074 00000 n
-0000178049 00000 n
-0000155138 00000 n
-0000151139 00000 n
-0000153025 00000 n
-0000151203 00000 n
-0000140569 00000 n
-0000146002 00000 n
-0000140633 00000 n
-0000126432 00000 n
-0000133614 00000 n
-0000126496 00000 n
-0000101099 00000 n
-0000114198 00000 n
-0000101163 00000 n
-0000080732 00000 n
-0000091259 00000 n
-0000080796 00000 n
-0000080227 00000 n
-0000079327 00000 n
-0000078963 00000 n
-0000078501 00000 n
-0000077183 00000 n
-0000076758 00000 n
-0000076291 00000 n
-0000075854 00000 n
-0000072668 00000 n
-0000073002 00000 n
-0000073158 00000 n
-0000076140 00000 n
-0000076586 00000 n
-0000077043 00000 n
-0000078037 00000 n
-0000078795 00000 n
-0000079247 00000 n
-0000080558 00000 n
-0000082042 00000 n
-0000091204 00000 n
-0000091375 00000 n
-0000091441 00000 n
-0000091472 00000 n
-0000091749 00000 n
-0000091824 00000 n
-0000102529 00000 n
-0000114314 00000 n
-0000114380 00000 n
-0000114411 00000 n
-0000114688 00000 n
-0000114763 00000 n
-0000127223 00000 n
-0000133730 00000 n
-0000133796 00000 n
-0000133827 00000 n
-0000134103 00000 n
-0000134178 00000 n
-0000141446 00000 n
-0000146118 00000 n
-0000146184 00000 n
-0000146215 00000 n
-0000146508 00000 n
-0000146583 00000 n
-0000151556 00000 n
-0000153141 00000 n
-0000153207 00000 n
-0000153238 00000 n
-0000153530 00000 n
-0000153605 00000 n
-0000156876 00000 n
-0000178165 00000 n
-0000178231 00000 n
-0000178262 00000 n
-0000178555 00000 n
-0000178630 00000 n
-0000202059 00000 n
-0000228239 00000 n
-0000228305 00000 n
-0000228336 00000 n
-0000228629 00000 n
-0000228704 00000 n
-0000254922 00000 n
-0000255143 00000 n
-0000255262 00000 n
-0000255367 00000 n
-0000255458 00000 n
-0000255549 00000 n
-0000255655 00000 n
-0000255851 00000 n
-0000255883 00000 n
-0000268483 00000 n
-0000268571 00000 n
-0000265290 00000 n
-0000257856 00000 n
-0000258107 00000 n
-0000265561 00000 n
-0000271957 00000 n
-0000271527 00000 n
-0000271093 00000 n
-0000270661 00000 n
-0000269617 00000 n
-0000269672 00000 n
-0000269970 00000 n
-0000270048 00000 n
-0000270205 00000 n
-0000270426 00000 n
-0000270501 00000 n
-0000270581 00000 n
-0000270716 00000 n
-0000271015 00000 n
-0000271148 00000 n
-0000271449 00000 n
-0000271582 00000 n
-0000271879 00000 n
-0000272012 00000 n
-0000272311 00000 n
-0000272465 00000 n
-0000272712 00000 n
-0000273723 00000 n
-0000284180 00000 n
-0000349769 00000 n
-0000415358 00000 n
-0000480947 00000 n
-0000539701 00000 n
-0000536321 00000 n
-0000536385 00000 n
-0000535680 00000 n
-0000535744 00000 n
-0000535040 00000 n
-0000535104 00000 n
-0000534399 00000 n
-0000534463 00000 n
-0000533781 00000 n
-0000533845 00000 n
-0000533161 00000 n
-0000533225 00000 n
-0000532541 00000 n
-0000532605 00000 n
-0000532721 00000 n
-0000532787 00000 n
-0000532818 00000 n
-0000533086 00000 n
-0000533341 00000 n
-0000533407 00000 n
-0000533438 00000 n
-0000533706 00000 n
-0000533961 00000 n
-0000534027 00000 n
-0000534058 00000 n
-0000534324 00000 n
-0000534579 00000 n
-0000534645 00000 n
-0000534676 00000 n
-0000534965 00000 n
-0000535220 00000 n
-0000535286 00000 n
-0000535317 00000 n
-0000535605 00000 n
-0000535860 00000 n
-0000535926 00000 n
-0000535957 00000 n
-0000536246 00000 n
-0000536501 00000 n
-0000536567 00000 n
-0000536598 00000 n
-0000536888 00000 n
-0000539271 00000 n
-0000538842 00000 n
-0000538409 00000 n
-0000537978 00000 n
-0000537548 00000 n
-0000537603 00000 n
-0000537900 00000 n
-0000538033 00000 n
-0000538331 00000 n
-0000538464 00000 n
-0000538764 00000 n
-0000538897 00000 n
-0000539193 00000 n
-0000539326 00000 n
-0000539623 00000 n
-0000540342 00000 n
-trailer <</Size 971/Root 1 0 R/Info 970 0 R/ID[<07511D2C75694DC89622C9F4B35B7624><8DE5252BE861447E9DAABAECF80D68A1>]>> startxref 540533 %%EOF \ No newline at end of file
diff --git a/doc/logos/eps/icon_taler.eps b/doc/logos/eps/icon_taler.eps
deleted file mode 100644
index 79ab648a..00000000
--- a/doc/logos/eps/icon_taler.eps
+++ /dev/null
Binary files differ
diff --git a/doc/logos/fonts/OldNewspaperTypes.ttf b/doc/logos/fonts/OldNewspaperTypes.ttf
deleted file mode 100644
index 7b9cf31b..00000000
--- a/doc/logos/fonts/OldNewspaperTypes.ttf
+++ /dev/null
Binary files differ
diff --git a/doc/logos/fonts/perpetue/Perpetua.ttf b/doc/logos/fonts/perpetue/Perpetua.ttf
deleted file mode 100644
index 846b3dca..00000000
--- a/doc/logos/fonts/perpetue/Perpetua.ttf
+++ /dev/null
Binary files differ
diff --git a/doc/logos/fonts/perpetue/Perpetua_Bold.ttf b/doc/logos/fonts/perpetue/Perpetua_Bold.ttf
deleted file mode 100644
index c73833db..00000000
--- a/doc/logos/fonts/perpetue/Perpetua_Bold.ttf
+++ /dev/null
Binary files differ
diff --git a/doc/logos/fonts/perpetue/Perpetua_Bold_Italic.ttf b/doc/logos/fonts/perpetue/Perpetua_Bold_Italic.ttf
deleted file mode 100644
index 3882fe92..00000000
--- a/doc/logos/fonts/perpetue/Perpetua_Bold_Italic.ttf
+++ /dev/null
Binary files differ
diff --git a/doc/logos/fonts/perpetue/Perpetua_Italic.ttf b/doc/logos/fonts/perpetue/Perpetua_Italic.ttf
deleted file mode 100644
index e4f295ed..00000000
--- a/doc/logos/fonts/perpetue/Perpetua_Italic.ttf
+++ /dev/null
Binary files differ
diff --git a/doc/logos/ico/favicon1616.ico b/doc/logos/ico/favicon1616.ico
deleted file mode 100644
index 141b93d3..00000000
--- a/doc/logos/ico/favicon1616.ico
+++ /dev/null
Binary files differ
diff --git a/doc/logos/ico/favicon4848.ico b/doc/logos/ico/favicon4848.ico
deleted file mode 100644
index 3c04b126..00000000
--- a/doc/logos/ico/favicon4848.ico
+++ /dev/null
Binary files differ
diff --git a/doc/logos/png/icon_taler.png b/doc/logos/png/icon_taler.png
deleted file mode 100644
index b1dd9a58..00000000
--- a/doc/logos/png/icon_taler.png
+++ /dev/null
Binary files differ
diff --git a/doc/logos/png/logo_taler.png b/doc/logos/png/logo_taler.png
deleted file mode 100644
index bdffc3c9..00000000
--- a/doc/logos/png/logo_taler.png
+++ /dev/null
Binary files differ