summaryrefslogtreecommitdiff
path: root/doc/logos
diff options
context:
space:
mode:
authorChristian Grothoff <christian@grothoff.org>2015-01-08 18:37:20 +0100
committerChristian Grothoff <christian@grothoff.org>2015-01-08 18:37:20 +0100
commit57d1f08dbca256f5fe16d57b29bfa523dec8f6c4 (patch)
tree3b3ee5f3b8c174887217e5c465048dea4e79bae2 /doc/logos
downloadexchange-57d1f08dbca256f5fe16d57b29bfa523dec8f6c4.tar.gz
exchange-57d1f08dbca256f5fe16d57b29bfa523dec8f6c4.tar.bz2
exchange-57d1f08dbca256f5fe16d57b29bfa523dec8f6c4.zip
-initial import for mint
Diffstat (limited to 'doc/logos')
-rw-r--r--doc/logos/ai/logotalerv2.ai3474
-rw-r--r--doc/logos/eps/icon_taler.epsbin0 -> 242881387 bytes
-rw-r--r--doc/logos/eps/logo_taler.epsbin0 -> 10731812 bytes
-rwxr-xr-xdoc/logos/fonts/OldNewspaperTypes.ttfbin0 -> 85804 bytes
-rw-r--r--doc/logos/fonts/perpetue/Perpetua Bold Italic.ttfbin0 -> 75620 bytes
-rw-r--r--doc/logos/fonts/perpetue/Perpetua Bold.ttfbin0 -> 58512 bytes
-rw-r--r--doc/logos/fonts/perpetue/Perpetua Italic.ttfbin0 -> 76080 bytes
-rw-r--r--doc/logos/fonts/perpetue/Perpetua.ttfbin0 -> 60216 bytes
-rwxr-xr-xdoc/logos/fonts/smoth_bight/End User Licence Agreement.txt133
-rwxr-xr-xdoc/logos/fonts/smoth_bight/Licencia de la fuente - Version en Espa§ol.txt77
-rwxr-xr-xdoc/logos/fonts/smoth_bight/Smoth-Bight - Por Kustren.otfbin0 -> 50396 bytes
-rwxr-xr-xdoc/logos/fonts/smoth_bight/Smoth-Bight Italic - Por Kustren.otfbin0 -> 50820 bytes
-rw-r--r--doc/logos/ico/favicon1616.icobin0 -> 1150 bytes
-rw-r--r--doc/logos/ico/favicon4848.icobin0 -> 15086 bytes
-rw-r--r--doc/logos/png/icon_taler.pngbin0 -> 1835737 bytes
-rw-r--r--doc/logos/png/logo_taler.pngbin0 -> 377176 bytes
16 files changed, 3684 insertions, 0 deletions
diff --git a/doc/logos/ai/logotalerv2.ai b/doc/logos/ai/logotalerv2.ai
new file mode 100644
index 00000000..d474079d
--- /dev/null
+++ b/doc/logos/ai/logotalerv2.ai
@@ -0,0 +1,3474 @@
+%PDF-1.5 %
+1 0 obj <</Metadata 2 0 R/OCProperties<</D<</ON[5 0 R 248 0 R 489 0 R 730 0 R]/Order 731 0 R/RBGroups[]>>/OCGs[5 0 R 248 0 R 489 0 R 730 0 R]>>/Pages 3 0 R/Type/Catalog>> endobj 2 0 obj <</Length 50398/Subtype/XML/Type/Metadata>>stream
+<?xpacket begin="" id="W5M0MpCehiHzreSzNTczkc9d"?>
+<x:xmpmeta xmlns:x="adobe:ns:meta/" x:xmptk="Adobe XMP Core 5.3-c011 66.145661, 2012/02/06-14:56:27 ">
+ <rdf:RDF xmlns:rdf="http://www.w3.org/1999/02/22-rdf-syntax-ns#">
+ <rdf:Description rdf:about=""
+ xmlns:dc="http://purl.org/dc/elements/1.1/">
+ <dc:format>application/pdf</dc:format>
+ <dc:title>
+ <rdf:Alt>
+ <rdf:li xml:lang="x-default">logotalerv2</rdf:li>
+ </rdf:Alt>
+ </dc:title>
+ </rdf:Description>
+ <rdf:Description rdf:about=""
+ xmlns:xmp="http://ns.adobe.com/xap/1.0/"
+ xmlns:xmpGImg="http://ns.adobe.com/xap/1.0/g/img/">
+ <xmp:CreatorTool>Adobe Illustrator CS6 (Macintosh)</xmp:CreatorTool>
+ <xmp:CreateDate>2014-09-16T12:36:31+02:00</xmp:CreateDate>
+ <xmp:ModifyDate>2014-09-18T11:52:58+02:00</xmp:ModifyDate>
+ <xmp:MetadataDate>2014-09-18T11:52:58+02:00</xmp:MetadataDate>
+ <xmp:Thumbnails>
+ <rdf:Alt>
+ <rdf:li rdf:parseType="Resource">
+ <xmpGImg:width>256</xmpGImg:width>
+ <xmpGImg:height>192</xmpGImg:height>
+ <xmpGImg:format>JPEG</xmpGImg:format>
+ <xmpGImg:image>/9j/4AAQSkZJRgABAgEASABIAAD/7QAsUGhvdG9zaG9wIDMuMAA4QklNA+0AAAAAABAASAAAAAEA&#xA;AQBIAAAAAQAB/+4ADkFkb2JlAGTAAAAAAf/bAIQABgQEBAUEBgUFBgkGBQYJCwgGBggLDAoKCwoK&#xA;DBAMDAwMDAwQDA4PEA8ODBMTFBQTExwbGxscHx8fHx8fHx8fHwEHBwcNDA0YEBAYGhURFRofHx8f&#xA;Hx8fHx8fHx8fHx8fHx8fHx8fHx8fHx8fHx8fHx8fHx8fHx8fHx8fHx8fHx8f/8AAEQgAwAEAAwER&#xA;AAIRAQMRAf/EAaIAAAAHAQEBAQEAAAAAAAAAAAQFAwIGAQAHCAkKCwEAAgIDAQEBAQEAAAAAAAAA&#xA;AQACAwQFBgcICQoLEAACAQMDAgQCBgcDBAIGAnMBAgMRBAAFIRIxQVEGE2EicYEUMpGhBxWxQiPB&#xA;UtHhMxZi8CRygvElQzRTkqKyY3PCNUQnk6OzNhdUZHTD0uIIJoMJChgZhJRFRqS0VtNVKBry4/PE&#xA;1OT0ZXWFlaW1xdXl9WZ2hpamtsbW5vY3R1dnd4eXp7fH1+f3OEhYaHiImKi4yNjo+Ck5SVlpeYmZ&#xA;qbnJ2en5KjpKWmp6ipqqusra6voRAAICAQIDBQUEBQYECAMDbQEAAhEDBCESMUEFURNhIgZxgZEy&#xA;obHwFMHR4SNCFVJicvEzJDRDghaSUyWiY7LCB3PSNeJEgxdUkwgJChgZJjZFGidkdFU38qOzwygp&#xA;0+PzhJSktMTU5PRldYWVpbXF1eX1RlZmdoaWprbG1ub2R1dnd4eXp7fH1+f3OEhYaHiImKi4yNjo&#xA;+DlJWWl5iZmpucnZ6fkqOkpaanqKmqq6ytrq+v/aAAwDAQACEQMRAD8A9U4q7FXYq7FXYq7FXYq7&#xA;FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7F&#xA;XYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYqkHn&#xA;Lz35W8naZ+kdfvktYmqIIftTTMP2Yox8THffsO5AxV4lqP55fmf5v5jyLpUWi6QWMUer6gY2kZqh&#xA;fh9T9yp5OoYBX41BJAxViV/5Y826oyt5w87zrLKob6pPctDGrcI2YKJGSIhGnUHgvVZBtxrgVJrn&#xA;yn5NW48x2ei3VvNBc2trHpV5qFeSTGaJ7hlkeNaHgsg5UGx232CrI28syWOl2d95U8z3OixW0U1x&#xA;eXsdxcMsscdsvFOCSUaQTW8hZBGPhkBPZcKo22/Pf81vImox6Z5yt7fW4CCSwaNLkKkjRN+9gqnJ&#xA;WQ1WROXiRir3TyD+ank7zxal9Gu6XkahrjTpwI7mP5pU8l/ylJGKsuxV2KuxV2KuxV2KuxV2KuxV&#xA;2KuxV2KuxV2KuxV2KuxV2KuxV2KuxV2KuxV2KsG/Nb80tO8iaRGwj+va9fkxaRpaVLSyHbmwX4vT&#xA;UkVpuTsPZV4GnlTUNVv280/mTPLqGrXgKWNjs9vzV2UWy/Vnd+akf3SJxUtVyxDpir1Hy9+WWp30&#xA;cE2pXcuk2jxktp9okdvM3xzKpd46rCXhmpJHDRflsALVnej+QfJukqPqOk2yuNzO6CWUnxMj8nr9&#xA;OBKerFEiBFRVQbBQABiqUar5L8p6sjJqGk2txyFC5iUP9DqA4+g4q8y8/wD/ADj/ABan6l/ot3LN&#xA;d8afVL2QyVVRskczfEPYPX5jDavnnUNH8w+Vdb+s2rT6Zq1hJUMKxyxN/Qg/Ij2xQ+nPyQ/O2Dzr&#xA;anSNY4W/ma1QFwKKlyg29WMdiP21+kbdCr1rFXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FUv1zzDoWg&#xA;2Rvda1CDTrUbercyLGCfBeR+I+w3xV5Tr3/OVX5c2EjRaZDe6y42EsEQhh2/ypyj/cmKsXk/5zCI&#xA;ciLygzJ2ZtQCn7hbN+vFUXp//OX2ku6/pPyzc20f7TW1zHcEfIOlvX78VeieVPz2/LLzLIlva6st&#xA;leyEBbO/H1ZyT0Cs37pifBXJxVn4IIqOmKuxV2KuxVB6zq9ho2k3mrahJ6VlYwvcXEngkaljQdzt&#xA;sO5xV8iwebtY8yeYtS82eYtHt7zTdYSQaUblDJ9UW0bjAsRhKXCJzkEbvGU5SGvKoIwK96/LnyC9&#xA;rOfNGuxV128QejAzNILSGlFjDPVjIV/vHO5NfE1BKUg/5yM8t2d1odnrJjv7q/tri2t4LW0SeWP0&#xA;DcpLdMyQq1CYUarNtQUG+IV2p3+teTvyj05vKz3c11LJDbQSSQPdyxIUdhyQglalAnJkNK0pWmKq&#xA;HmHzHrHmLyL5R1WeyuYdRGs2T3KRwTKyD05BI7KAWSOp/b26VxVX/MLV/wAx7Tzl5XOjTXcOhNDE&#xA;0v1eD14pbgzFbiO7+AqqegV4s0qcdyvJgFxVOTq3nqf8z/qkd3c2/l+Kzs5fqz2iC1mnlE4uFS5a&#xA;HmxSkLfDLsdqeCqZfmb+W9l5v0kvGqxa5bIfqdz0D9zDJ4q3Y/snfxBVfId4mr+Wddi1KyL2Wpaf&#xA;PUA/C0csbUZHHzBVh9GFD7S/LTzzaedfKdprUAEcrjhdQVqY5V2dT9PT2wqyrFXYq7FXYq7FXYq7&#xA;FXYq7FXYq7FXin5w/wDORVj5Xnm0Dywseo+YEql1cNVre0b+U0/vJR/KDRe+9VxV87vZ+cfO2r/X&#xA;tWubjU76c0V5KudzXjGg+FV8FUAe2BXp/lr/AJxs1y5jSW+WOzQ0NJ2q9P8AUQNT6aY2rMoP+ca9&#xA;LVBz1MBu4W3qPvMgxtUJqf8AzjTCyH6nfQyt2EsbRfipkxtXmPm/8kNf0ZWkltWWEdJk+OL/AIJa&#xA;0+mmKrPIv5vefPy8uI7OZm1PQVID6bcsTwUf8s8hqYj7br7d8VfV/knzz5d856KmraHcerCTxnha&#xA;izQyUqY5UqeLD7j1BIwqn+KuxV5D/wA5Da2fqWg+U4b02V3r94GSQQrcKfqjI0aSozIoR53jqzVF&#xA;AdiK4qlfljyvb3HnOy0WNIRp+jKdTvzayh4Jpmcrb0jiWKCMScfW4JGo6dTVmBV6j5xn1C38pa1P&#xA;pt3Dp+oRWNw9pf3JVYLeVYmKTSlw6hI2+JiykUG4wJfJDfmr+eXJkk/MLRpFBoSs+lUPyrBhQqR/&#xA;mr+cITg/n3S+P8q3Ojgfcbc4qxq5/wCcg/zohuJ7eLzOJIonaPnHa6e6MVNCVZYOLLtsw6jGlT2y&#xA;/OT83b60SVfPNjGDQqlzJpULU7Vje2qp9q40q9/zW/O4kFPP+j1HQtPpJp/yQxV7Z+QPmf8AMbWL&#xA;W4bzXqVtrMTuz2moWrQMhjACFAbdY0PF1bt9OApYt/zkh5PitdYt9bt0CwauhjuaDYXMIFG8P3kf&#xA;/EScIQlP/OLfmyXTfNN75amaltqA9eFSdhLH8LU/1gR92FX1ZirsVdirsVdirsVdirsVdirsVeKf&#xA;85FfnDN5XsF8saBP6fmHUY+VxcofitLZqiqntLJSi9wPi68Tirwz8svy01LzRqaRxoSCec0z14ot&#xA;d3c/51wK+tPKPkbQfK9msNhCGueNJrxwPUc96fyr/kjAlkOKuxV2KrXjSRGSRQ6MKMrCoIPYg4q8&#xA;j/M/8mLDULSbUNFgCyqC01ko2I7mL3/yfu8MNq8D8seZvMH5Z+bI9VsKyWzER31kxIjuIa7o3+UO&#xA;qN2PtUFQ+0vLvmDS/MOh2Wt6XL61hfRiWB+hodirDsysCrDsRhVMcVfOH51W0uqfnbo6TQxT6ZYW&#xA;AhZJ51hj+sSpcTDkxDsmwQ1VSRSo3xVn/wCTmnRxL5hvPTWKZtQ+pFEkkmASyhSJR6kxMjUNd23y&#xA;JS9BvLO1vbSezu4UuLS5jaG4t5VDxyRyAq6OrAhlZTQg4q82uf8AnHL8rJ53l/REMfMk8I4o1UV7&#xA;ABaAY2qn/wBC2flZ/wBWuP8A4CP/AJpxtXyZ5g8tW9p5m8w2donG1s9UvraBadI4bmSNRt4Bckh7&#xA;f+Rn5KeQ/Mnke01LVbFJrqRFLuVQmpHuDgJS9E/6Fs/Kz/q1x/8AAR/804LVlPk78t/LXlEt+hoj&#xA;CjKV9IEBACeRooAA3xVJPz809Lr8tr2cir6fNb3Mfz9UQsf+AmbEK+YfId6+mfmdo1yhp/pQU08H&#xA;BX+OSQ+60bkgbxFcVbxV2KuxV2KuxV2KuxV2KoHXdZstE0W+1i+bhaafBJcznvxiUsQK9zSgHjir&#xA;4WW61Xzt5yu9YvgZLzUrgysgq3EMaRxL34otFX2GBX2T5A8n2vlfy/BZIi/W5AHvZR1aSn2a+C9B&#xA;9/fAljmqf85E/k7pWqXmlX+vmK/0+eS1u4RZ3z8JoXMci8kgZTRlIqCRjSqSf85J/ku/2Nfkb5af&#xA;qJ/7F8aVbL/zkv8AkpC3GXzC8bHcB7DUVNPpt8aVdH/zkn+TEq84tekkUdWXT9RI+8W+NKtb/nJb&#xA;8lU+15gdfnYaiP8AsXxpU88mfnF+XHnTVZdK8s6v9fv4YGupYfq11DSFHSNm5TxRr9qRRStd8Vea&#xA;/n5+XsCE6vaRhYLsn1VA2Saldv8AW6/fhCEu/wCcVvOk1pq2oeSL2T9zOGvNMVj9mWPaeNf9dKPT&#xA;/JPjhV9L4q+WP+ciPNHmLQPzHnstMuWs49RtrO8e4iLLKREJYAlQ3EpUE/ZrXvir1H/nHy5a58j3&#xA;E8knq3EmoTvO9KEu6RuTtQb8siUvTcVdirsVfIFzoBvNb8z3AWtdc1YVp4X0wySHs3/ONIp+W9kP&#xA;BV/VkSl6zirsVYH+eU0cX5W64XNOa26KPFmuYgMQr5M0NTJ570lV3P1qI0Hsa4UPvS3/ALiP/VH6&#xA;sKqmKuxV2KuxV2KuxV2KuxV4/wD85Ta5Jp/5YGxiYq+sXsFo9OvppyuG3+cIB+eKvK/+cb/Lkd95&#xA;nhuZUqlmrXRB8Uoqfc7A4Cr6rwJeJ+YPy0/Me817Uruz8q/lvcWtxdTy29xqFhdPeSRvIzI9y6xl&#xA;WmZTWQjq1cVQI/K381R08o/lcP8At3Xn/VPFXhf54+WvMemedbSy1zT9B026OmxTpbeWYZbezKNP&#xA;Mgd0lCsZiUIY/wAoXwwhDLvyK8l+edY8q38+iaJ5N1O0g1GSBp/M1rcXF4riCFzHG0SsohpIGA/m&#xA;LHviVein8rPzUPXyh+Vp/wC3def9U8CWcflb5J17QrrULvzBoPlLS7uRI4rG48rWklvI0ZLNOlw8&#xA;qKxUssZUL4GvbFWT+dtJTVfK2o2rLyb0mli8ecY5inzpTFXyFpF+3ln80NE1VTwS3voTMen7p39O&#xA;YfTG7DCh9xYVfNX/ADl55fdLry95jjUmMiXT7l+wIPqwj6f3n3Yqjv8AnGDzJGy6hokjgNMi3Vup&#xA;/mj+CQD3IKn6MBV79gS7FXYq+bNI1Cyhl80RSgeodd1ihPvfTZJDO/8AnGw1/Lm0I6UXIlL1jFXY&#xA;q8k/P/UUurfQvKUcnGXVLsXN2RU+naWwPN3ChiFDMGrQ/ZOxxCvKtHn0rzd+dOnNokFv+jrMoxub&#xA;aORPUbioPISpEwChOKjj798kh9cgUAHhirsVdirsVdirsVdirsVdir54/wCcwZWGl+V4duD3Ny58&#xA;aokYH/EzgVd/zi/Egj1CTbkIIwPGhap/ViVe+YEuxV2Kvl3/AJyP003v5s2wArw0K0/G8vP6YQhn&#xA;n/OLVsbbybr8J2467L+NjZnAUvZsVdirTqrqVbdWBBHscVfDP5jLw1Esp4sCSCNiCMKH3hhViP5r&#xA;eSo/OXkbUtFoPrTJ61g5/ZuIvij37An4T7E4q+O/InmTU/KvmaGfi0N9p85WWB6qQyEpJE/hUVU4&#xA;Ffa/lzzBp3mDRrbVtPfnb3C1p+0jD7SNToynY4EplirsVfFesa41r5l80wBqcdb1Xb53spySHvX/&#xA;ADjQa/lrZHxRf1ZEpetYqhdT1Ow0vT7jUdQmW3srVGlnmfYKqip/sHfFXzZf+bbrULrXPzIvY2ij&#xA;9P6tolsJza3cVpG4XnCxVl+PmVdlaodiFr9lihkv/OM3lK9kN95t1RSbu9laQOVCVZ6liFUBQKno&#xA;NsKvoHFXYq7FXYq7FXYq7FXYq7FXhv8Azlvpkk/kbS9RQEix1FVlA6BJ4nXkf9mqj6cVY3/zjBqs&#xA;a6jcWTGhnt24DxaNgaf8DywFX0bgS7FXYq8L/MzTEv8A84nRv2fL9kRX/mMvcIQyb8h7VbXTfNMC&#xA;9E11x/3LrLAUvTsVdiqF1W8Wy0y7u2NBbwvJX/VUnFXxVrlodc856dpMY5NfXcNsAP8Ai6VU7fPC&#xA;h90YVdir5s/5yN/J6dbp/Ovl6DkW31e1jG5Kj+/UeNPtAfPFWB/lT+beo+Vb4UJuLCagu7Jmor9g&#xA;6nfi48foOBX1V5V85+XvNFkLrSLpZSADNbNRZoiezx1qPn0PY4Ep5ir89vPmoGHz95ujrSmtal+N&#xA;3JkkPq7/AJxl/wDJZ2H/ABjT9WRKXo3mLzPoPlywN9rN4lpBuEDGryN/JHGKu7eyjFXhfm384dSu&#xA;9WjvdS0s23lGGUxR2zshuw6ShTePEGYMEZeHFkKbleXMgg0hiei2Oqfmhr1tpljYwWXlzTJBxaKN&#xA;k9VY5JPTkb1GdwAszcU5bVpvQYVfV+haLZaLpcGn2aBIYVoABSp7nFUfirsVdirsVdirsVdirsVd&#xA;irGfzL8qDzZ5F1nQQB693bk2hbYC4iIkhJPYeoi19sVfIH5VeZ7ny55ntpnVkltpaSxNs23wSIQe&#xA;hpUYFfa1nd295aQ3ds4kt50WSJx0KsKg4Eq2KuxV8+/nDqx0783uYbiX0CyH3Xl7hCGW/wDOPV39&#xA;b0PzNcVrz119/lp9kMBS9VxV2KvOvzq81Q6V5cOno4Fze7uK7iJTX/hmFPvxCvGP+cevLcvmT80G&#xA;1yWMvp+go1wzn7JnkBjgX5/akH+rkkPrXFXYqtkjSRGjkUMjCjKdwQcVfO/5tf8AOOHrzz655RKw&#xA;zNWSfTqURm7lOI+EnFXhyal5k8samEu0uNPv7dvgkBaKRSO6OtPwOBXo+hf85IedLKNY5riDUEUB&#xA;R9ci+IAf5cRiJPu1caViXmz8mb/Wdb1rVLTUTNquqSpqcVosMaQ89Rmjkki5md3AiF4vxOi1ofnh&#xA;VnXkC9/MLy75cPlpNWsNHktrVp7doYxeXEsUUpheXYzIIlEcjM6qSApNOmClSjVLzQtN1S6vNdvp&#xA;vMfmO2aezkiuf38sV1G7xBPq0p+xGQsgZiY2WqcQ1DhVNdI8n+evzNv63iPpPlzkGS1ZnkJVT8Hq&#xA;ysAZWChV7A8QTVt8VfRXk7yZo/lbTFstPjANB6ktAGYgUqaYqn+KuxV2KuxV2KuxV2KuxV2KuxV2&#xA;KvlP/nI/8tJ/L3mI+ddJiP6J1SUHUFQbQXjdXP8Akzdf9aviMVZH+Rv5uWsdtHoerS8bZm/0adjt&#xA;E7dVb/IY717H57AhXv4IIqNwehwJbxV8o/8AOT9+bT82LMg056Fa/heXeEIehf8AOJ9wbjyLrkx/&#xA;a12b8LK0GApe2YqlPmXzLpnl7TXvr5wAKiKIH4pG/lX+J7Yq+S/zB836x5u8w/VrVWur++lWGC2i&#xA;BJJY8UjQYUPp/wDKP8vYPIvk630tuL6lOfrOqzruGuHABVT/ACxgBF+Ve5wqzTFXYq7FXYqx/wAy&#xA;+Q/K/mOFo9Vskm5dX6HFXlet/wDOKnla4dn027ltSTUJ1A/HFUJcfkF56L1j81XI+wDIrBHPpMjR&#xA;lnWjMUMScSTtQYquh/5xnvb2NINb8w3d3bJIZVt5JHdA7dWVGYqCfGmKs58rfkX5H0BklW3NzOm/&#xA;OQ7V8aDFXoMMEMEaxwoEjUUVRsAMVX4q7FXYq7FXYq7FXYq7FXYq7FXYq7FUNqmmafqunXGnajAl&#xA;zY3cbRXEEgqrowoQcVfJH5ofkt5i/L+9k1jRBLqHlgkt6yjlLagn7FwB+yO0nTxoeoVOPy3/AD9v&#xA;9Lhjsb7/AEuyWgWKRqOg/wCK3329jt8saV7lon5peS9WjUx362srdYrn93T/AGZ+D/hsFJfL/wDz&#xA;l5qVtJ+Z+mTW0yTRHRIB6kbB1qLu62qtcIQ9G/5xI8w6NYflnqz6hfQ2zNrc7BJHVWK/VLUVC/aP&#xA;TsMSlnPmr89PLumxOmlj63OAaTSVSIe9DR2/DBSvA/MfnjzT531tLKwWbUdRum9OCGIV28FUbKo6&#xA;k9B1OFD3j8lfyPg8nKNc1wrd+aJ0K7UeK0VuqxHvIw2d/oG1SxV63irsVdirsVUJr2CGT025s9Ax&#xA;WOOSQgEkAngrUrQ4qs/Sdt/JP/0jz/8ANGKu/Sdt/JP/ANI8/wDzRirv0nbfyT/9I8//ADRirv0n&#xA;bfyT/wDSPP8A80Yq79J238k//SPP/wA0Yq79J238k/8A0jz/APNGKuXUrUsqkSpyIUF4ZUWrGgHJ&#xA;lA3OKorFXYq7FXYq7FXYq7FXYq7FXYq7FXYq0yqylWAKkUIO4IOKvJPPX/ONXknzDLJe6QzeXtSc&#xA;lma2UPbOx7tbkqF/55svyOKvJtU/5x8/ODRXY6b9X1i3WpRradY34jxSf0t/ZScVSZ/Kf5z2zenJ&#xA;5b1Bm8Y4mkHh9pOQxVEWv5c/nfqhCxaDcQq1KtcPFbgA+Pquh/DArMPLv/OLPmS/kWbzbrUdrAd2&#xA;tbGs0pHgZHCxofkr4Ve5+TPy88o+TbM22g2CW7uAJ7pv3lxLT/fkrfERXfiPhHYYqyPFXYqw/wA2&#xA;+b/N2nawmmeWvKx8xOlsLu9kN9FYrEru6RIvqo/N3MT+A264qi/IXnzS/OOlTXVrDNY31jO9nqul&#xA;XahLm0uY/tRyKPvVhsR71AVZLiqFj/46tx/xgg/4nLiqKxVak0Lu6I6s8dBIoIJUncVHbFWoZ4J0&#xA;LwSLKgZ4yyMGAeNijrUd1dSpHYimKvKfLsn5uyfm9rUd9c6HHp0dlpb3sMUd7K4s2nvzAsBaSNRO&#xA;SriV2Xj9khdiMVes4q87/wCcgLu6s/yp1S7tJWguYLrS5IZoyVZWXVLYggjFWdan/vMn/Ge3/wCT&#xA;6YqisVdirsVdirsVdirsVdirsVdirsVdirsVdirsVdirsVdirsVdirsVSa1/5TLVP+2dp/8Ayfvc&#xA;VYNp/o6L/wA5D69DGyw2et+WrfV9QJPFBPZXRtfUYn4R+6bc4qyny/L5f1LzJe69Za8uqyXcEcNj&#xA;aRTAwQWsdC7RRqxDmWU8mlpuOKjYbqovzJc3Nrpuv3NqxS6g0tpIHUVIkRZ2Ugb7gjFWC+WPLOkL&#xA;+T2j+ZrSD6v5lXQItSbWYdr2a6lsfUlaafeSb1HY8lcnt3Aoqhvy68s69ceSfJt3Y2+kWVs1vpOo&#xA;T6ohl/SMjMsM95zfgFZ7kmRHq2/I4qxfyP5Y0ZP+cfdS85mASeaLSLW9Ts9YkJe6gmsru5kjEMrV&#xA;eNGeHk6qaMS3IGpxVGfn3LLFp35lNG7IzaR5VRipIJWTWLxHU07MrEEdxirNYvJHkx/zCuNFbRLC&#xA;30i30q2vbfSorWGO2uriW4uIppZokVUmNskUQTmDw9UkbnFXjXmcJDB+demW11Jc6fpt35VtbCN5&#xA;GkEEYv8AmbeMkmixSOyBe1KYq+o9T/3mT/jPb/8AJ9MVSyTzLbWms6zFqd/p9ppel2tncPI83CWH&#xA;6w06u90ZOMUcbekoj3rs1e2KrtM88eStVjuZdL1/Tb+KzjMt5JbXcEywxjq8rI7BF92xVQ8rfoi5&#xA;vtU1ey1j9LS6m8cnESco7e3RfThjiiqeCHiz8qfGxJ6UoqyLFXYq7FXYq7FXYq7FXYq7FXYq7FXY&#xA;q7FXYq7FXYq7FXYqxK+80+WtE87Xses6raaY1zplnJB9cnjgDrDPd+oVMjLXj6i1+eKvG/OX1nzh&#xA;5f8AzP8AzDsY5W0ltJj0Ly5NxZWuLO1l9e8uFBofSeUnie4BxV69baZPc67oV/c+Zra6skkmvNF0&#xA;63t4ofVja2kiokiyOzxxxXHLYUrxOKsmmE0d5LKLdriOaKOMhCmxRnJ5B2TrzxVIdM8m+XdLnhks&#xA;tFuo47Zme0s2umktIGcEMYLSS5a3hNHYD00FATTqcVWaZ5H8s6ZcQzWOiXcUdrIZrSy+ts9lBIa/&#xA;HBZvctbRMORoUjFKmnXFUVHonl+w8tXOgLorW/l+4W5S4s2eERFL53edatNsJHmbYHatBTFUFN5P&#xA;8o6pBrX1jRptQh8wmIas0t164lFu5eFFZrlvSWJ2LIkXEKegxVNNa0ix1r0DfaZd+tbFjbXNtcfV&#xA;LiPnQOEntriKVVfiOShqN3xVKB+XXkoWd7aR+WpIoNS+qfXhFMI2lawnNzbO7pcK5dJmLl68mP2i&#xA;cVZBHBKLWGyitrhI45I29W5mEzUSUSHlI0ssrdNq1+7FXnt75aHmT8wfPuleuluzWvle5jlkiFxH&#xA;6lldXV0iyQlk9RGaEK68hUE74qx7849S8y2Ply/8uX+oadqVpNZpqM62Fm9nJbJYavpqyeqpuboG&#xA;N4bmQtVRQIeorir0rSNJvF822+oal5ih1O7TT7hLOxht44P9HuZrd2mJWSRnUNAqqem5xVluKuxV&#xA;2KuxV2KuxV2KuxV2KuxV2KuxVRu722tER7h+IkdY4wAWZnboFVQWO1SdtgCTsDiqsCCAQag7gjFX&#xA;Yq7FXYq7FUq1ryn5W114X1zRrHVXt6/V2vbaG4MddzwMqtxrTtiqZRwQxwrBHGqQooRIlAChQKBQ&#xA;o2pTtiqX6T5W8saPPNcaTpFlp1xcbTzWlvFA8gry+No1UtvvvirH9W8p+crvzwNXtPMUllov1L6u&#xA;lpGsbNDNzBLLHLFLHJ6ndiVZaUFQdlUd/hrzV/1N97/0i6f/ANk+Ku/w15q/6m+9/wCkXT/+yfFV&#xA;ax0nWLC7S61DV7jWYEVgsUkFuhidqD1VFvHGzHjVe/XFW7/S9Y1G8Nzp+rXOjwcFQqkEDGVlLEsy&#xA;3McjLSoA6V+VMVUP8Neav+pvvf8ApF0//snxV3+GvNX/AFN97/0i6f8A9k+KpfaeTvN8Pniy1qfz&#xA;NPdaVb2kkNzaSLEn1h3aqK0MUUcarH9r1Klz9nYdVWU3ei6PeC6F1YwTi+jSG99SJG9aKMsUjlqP&#xA;jRS7UVttz44qgdH8k+TNFeZ9G0DTtMe5T0rhrO0ggMkZ34OY0XkvscVROj+W/LuiLKujaXaaYs5D&#xA;TCzgitw5HQt6aryO/fFUxxV2KuxV2KuxV2KuxV2KuxV2KuxV2KsV8+NcTLpemx29u63V0JTc3QnZ&#xA;I3tB9YjVUtyjyPI0dOHMBl5V5CqlVk1q0z20LzKiTMimRI2LorEbhXITkoPQ8RXwxVUxV2KuxV2K&#xA;vmLVf+c0Y9P1S8sD5aMhtJ5IDIJwAxjcpWlDStMVQv8A0O/F/wBSw3/SQP8AmnFXf9Dvxf8AUsN/&#xA;0kD/AJpxV3/Q78X/AFLDf9JA/wCacVd/0O/F/wBSw3/SQP8AmnFXf9Dvxf8AUsN/0kD/AJpxV3/Q&#xA;78X/AFLDf9JA/wCacVd/0O/F/wBSw3/SQP8AmnFXf9Dvxf8AUsN/0kD/AJpxV3/Q78X/AFLDf9JA&#xA;/wCacVd/0O/F/wBSw3/SQP8AmnFXf9Dvxf8AUsN/0kD/AJpxV3/Q78X/AFLDf9JA/wCacVd/0O/F&#xA;/wBSw3/SQP8AmnFXpf5I/n0v5n6hqloulHThpsMcpYyepz9VitOgpTjir1zFXYq7FXYq7FXYq7FX&#xA;Yq7FXYq7FWHefdU1OzlRYbu5s7RLG9ulFmsXr3d1bhGhtI3ljnCsylmVVTk9NtlYFVkmjG7OnRC7&#xA;m+sTKXX6xRVMqK5VJCEotXQBjxFPDbFUbirsVdirsVfmP5gsry986apaWUElzdz6hcJBbwo0kjsZ&#xA;moqIoLMT4DFULrXlvzFoUqQ63pd5pc0gJjjvYJbdmA6kCVVJxVLcVRmlKpvPiVXCxTOFYBhySF2W&#xA;oNQaEYqrfX5v99wf9I8H/NGKu+vzf77g/wCkeD/mjFXfX5v99wf9I8H/ADRirOfy1/LbzT55e+ls&#xA;LOA2Flb3TNccLGKt1HayS28I9bhUPKqK5GyqakjrirFNatdV0XVbnStRhtEvbR/TuEiSznVWoCR6&#xA;kIkjald6NsduuKoH6/N/vuD/AKR4P+aMVZR590AeWrjREgeKePV9F07V/jtrfkj3kAeSPaMVAkDc&#xA;fanzxViGqKq3nwqFDRwuQoCjk8Ss1ANhucVQmKuxV9Nf84P/APHf81f8wlt/ycfFX11irsVdirsV&#xA;dirsVdirsVdirsVdirsVdirsVdirsVdir84LK8u7H8ytZvbOZ7e7tTrU1vPGSrxyR21yyOrDcFWF&#xA;QcVZd+VXmLV/PdnrP5beZLubVotTsrm88vSXbmaW11SziaeNopJCXVZERw6g7/SaqvMdF0/SLm21&#xA;O51O++qLZ2xezgRQ8tzcswSKJQSOK7l3fso8SMVQ+k/71t/xguP+TD4qzGTyx5Z0fyh5d13Wlvb6&#xA;bzGbqSGCzmitlt4LSc2xLNJDcmV3dWIHwgDxriqbw/lrpx8q2er6bbXnmKXWLu/isDC6Waw2dg8U&#xA;fqyq6ykyymcUXlRaH7WKo26/LjyXoXkrV9e15r24ntdVsLK1srWWKOX/AEnTjeSW8kxSaNXQy8Xf&#xA;0m3joFHLZVB+XNF07TvMP1vS3mbTNZ8p67f2aXJVpowNOv7aSOR0CK5Sa2cBgoqKGg6YqiPN35ce&#xA;T9J/MC48iWQvxd2kUVxda7c3ULW6QrYrf3U31NLVXpHDzovr9uuKobyl5F8jebrDzNc6ZNqOny+W&#xA;tIvdU+r3UkE5u1t4mMTq0cUQhpLx5xnnsdn2xVT/ADt/3p8lf+Afon/Jg4qwZtI1LVNRkhsIGnkt&#xA;7EXc4Wg4QW1oJppCSQKKiE+/Qb4qk+Kproun6Rc22p3Op331RbO2L2cCKHlublmCRRKCRxXcu79l&#xA;HiRir6F/5wf/AOO/5q/5hLb/AJOPir66xV2KuxV2KuxV2KuxV2KuxV2KuxV2KuxV2KuxV2KuxV+b&#xA;Q/5T/wAwf6muf9Ql1irIf+cck+rfmUnmCXaw8tafqGq38m1FijtZIxWu28kqjFUyu/IXlWzPlSwu&#xA;ZNMtNN1DTdN1HWtRvrtodQ5ahGJZngTmF4QJJSNfTIYr8XI4q8q0n/etv+MFx/yYfFWZHzN5Y1jy&#xA;foGg6617YzeXDdJbXFjBFdLPBdz/AFgq6yzW3pukjNRhyBB6bbqr280eUtW8oWHlrVhf6bHol5eX&#xA;Gk3drHDfM0F8Yy8NwjyWI5oYVIkVt9/gGKqN95x0Q/l7e+UNPtbmKN9dh1azmndJD6EdnLbMspUJ&#xA;8ZZlYcVp1HbdVFaL528v21haG7S7F7pnlzUtCtIoo43imn1KXUCZJJGkRo0jTUF6IxYg9OuKqvm3&#xA;8z7XVvzVuPOtpZP9Uu4Ybe606cgF4W05LC8i5py2kT1FVvAgkdsVRflHz15F8oad5mtdNh1HUZ/M&#xA;uk3mlm6uY4bc2i3ELBEVI5phNWUpzkJT4V2SppiqR/mD5q0fzImgTWbXKXGlaNp2kSwTQxolbK3C&#xA;SSLKs0hblJXjVF+H3xVvyTo+m6pruspfwidLTyzqN5ArEgLPb6UzxPsRujbj3xVkI8t6HfafpNh5&#xA;W8v+XtUvbyxsl+uXmtumoS6hPbxmeNbL6/aqrrcu8aJ6R5UHWuKq135C8q2Z8qWFzJplppuoabpu&#xA;o61qN9dtDqHLUIxLM8CcwvCBJKRr6ZDFfi5HFWcf84P/APHf81f8wlt/ycfFX11irsVdirsVdirs&#xA;VdirsVdirsVdirsVdirsVdirsVdir81zrlvof5lX2p3NiupWkN/eJdae7tEs8MzSRSxmRasvJHIq&#xA;OmKpp5g/M/SW8uXflvyZ5bj8q6VqjI+st9alv7u6ER5RxNcSqhSJTvwVdz361VQd7580bVrLSjru&#xA;htfavotjFptncx3ZhtpYLYFbf61biJ3kManjWOaPkAK4ql35eeXbXzH5z0rRbrVo9EgvZhG2pSkg&#xA;JsTRSKDm/wBlKkCp64qyfU/JENrqV3aj8xtIhEE0kQhuJtXEycHK8ZKWAHMUo1O+KoX/AAjF/wCX&#xA;L0P/AJHax/2Q4q7/AAjF/wCXL0P/AJHax/2Q4qkiXVxJrf6HN2YYjcG1OpNNc0RQ/D13ozfAv22o&#xA;nTFU7/wjF/5cvQ/+R2sf9kOKu/wjF/5cvQ/+R2sf9kOKpl5c/L+31PXtP0+T8xdKnju50heK0m1U&#xA;zkO1D6YksQnIdfiIHiR1xVIDqUfkbzj5js7W7h8wwyWmpaMNRhdljlW9t3t/XViGqU51I3BIoGpR&#xA;sVb8mebPJHlu+07V5PL9/qOuaZNFd287anHDa/WIHEkbfV1s2k4q6iqmbf2xV17580bVrLSjruht&#xA;favotjFptncx3ZhtpYLYFbf61biJ3kManjWOaPkAK4q9m/5wf/47/mr/AJhLb/k4+KvrrFXYq7FX&#xA;Yq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FX55+Zfya/NafzHqs8PlPVJIZby4eKRbWQqytKxUg06&#xA;EYqln/KlPzc/6lDVf+kWX+mKu/5Up+bn/Uoar/0iy/0xV3/KlPzc/wCpQ1X/AKRZf6Yq7/lSn5uf&#xA;9Shqv/SLL/TFXf8AKlPzc/6lDVf+kWX+mKu/5Up+bn/Uoar/ANIsv9MVRB/KL85jD6R8qatxoFr9&#xA;UfkVHRC/HkV/ya0xVD/8qU/Nz/qUNV/6RZf6Yq7/AJUp+bn/AFKGq/8ASLL/AExV3/KlPzc/6lDV&#xA;f+kWX+mKu/5Up+bn/Uoar/0iy/0xV3/KlPzc/wCpQ1X/AKRZf6Yq7/lSn5uf9Shqv/SLL/TFX0F/&#xA;ziF5E85eWda8xy+YNFvNKiuba3SB7uFog7LI5YLyArSuKvp3FXYq7FXYq7FXYq7FXYq7FXYq7FXY&#xA;q7FXYq7FXYq7FX//2Q==</xmpGImg:image>
+ </rdf:li>
+ </rdf:Alt>
+ </xmp:Thumbnails>
+ </rdf:Description>
+ <rdf:Description rdf:about=""
+ xmlns:xmpMM="http://ns.adobe.com/xap/1.0/mm/"
+ xmlns:stRef="http://ns.adobe.com/xap/1.0/sType/ResourceRef#"
+ xmlns:stEvt="http://ns.adobe.com/xap/1.0/sType/ResourceEvent#">
+ <xmpMM:OriginalDocumentID>uuid:AF0436EA903B11DB90DFD5CCDBF73423</xmpMM:OriginalDocumentID>
+ <xmpMM:DocumentID>xmp.did:0180117407206811822AA5DFA83DBEE8</xmpMM:DocumentID>
+ <xmpMM:InstanceID>uuid:a78d6ca4-ee25-5f4f-9857-efe87b47a9ff</xmpMM:InstanceID>
+ <xmpMM:RenditionClass>proof:pdf</xmpMM:RenditionClass>
+ <xmpMM:DerivedFrom rdf:parseType="Resource">
+ <stRef:instanceID>uuid:d0c80ddf-8d24-9c4a-b5a2-f5403c78eac7</stRef:instanceID>
+ <stRef:documentID>xmp.did:F87F11740720681183D1ECDDA24ACDE7</stRef:documentID>
+ <stRef:originalDocumentID>uuid:AF0436EA903B11DB90DFD5CCDBF73423</stRef:originalDocumentID>
+ <stRef:renditionClass>proof:pdf</stRef:renditionClass>
+ </xmpMM:DerivedFrom>
+ <xmpMM:History>
+ <rdf:Seq>
+ <rdf:li rdf:parseType="Resource">
+ <stEvt:action>saved</stEvt:action>
+ <stEvt:instanceID>xmp.iid:0380117407206811822AABA902D116C4</stEvt:instanceID>
+ <stEvt:when>2014-09-11T14:30:24+02:00</stEvt:when>
+ <stEvt:softwareAgent>Adobe Illustrator CS6 (Macintosh)</stEvt:softwareAgent>
+ <stEvt:changed>/</stEvt:changed>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <stEvt:action>saved</stEvt:action>
+ <stEvt:instanceID>xmp.iid:0180117407206811822AA5DFA83DBEE8</stEvt:instanceID>
+ <stEvt:when>2014-09-16T12:36:28+02:00</stEvt:when>
+ <stEvt:softwareAgent>Adobe Illustrator CS6 (Macintosh)</stEvt:softwareAgent>
+ <stEvt:changed>/</stEvt:changed>
+ </rdf:li>
+ </rdf:Seq>
+ </xmpMM:History>
+ </rdf:Description>
+ <rdf:Description rdf:about=""
+ xmlns:illustrator="http://ns.adobe.com/illustrator/1.0/">
+ <illustrator:StartupProfile>Video</illustrator:StartupProfile>
+ <illustrator:Type>Document</illustrator:Type>
+ </rdf:Description>
+ <rdf:Description rdf:about=""
+ xmlns:xmpTPg="http://ns.adobe.com/xap/1.0/t/pg/"
+ xmlns:stDim="http://ns.adobe.com/xap/1.0/sType/Dimensions#"
+ xmlns:stFnt="http://ns.adobe.com/xap/1.0/sType/Font#"
+ xmlns:xmpG="http://ns.adobe.com/xap/1.0/g/">
+ <xmpTPg:NPages>1</xmpTPg:NPages>
+ <xmpTPg:HasVisibleTransparency>True</xmpTPg:HasVisibleTransparency>
+ <xmpTPg:HasVisibleOverprint>False</xmpTPg:HasVisibleOverprint>
+ <xmpTPg:MaxPageSize rdf:parseType="Resource">
+ <stDim:w>1920.000000</stDim:w>
+ <stDim:h>1080.000000</stDim:h>
+ <stDim:unit>Pixels</stDim:unit>
+ </xmpTPg:MaxPageSize>
+ <xmpTPg:Fonts>
+ <rdf:Bag>
+ <rdf:li rdf:parseType="Resource">
+ <stFnt:fontName>OldNewspaperTypes</stFnt:fontName>
+ <stFnt:fontFamily>OldNewspaperTypes</stFnt:fontFamily>
+ <stFnt:fontFace>Regular</stFnt:fontFace>
+ <stFnt:fontType>TrueType</stFnt:fontType>
+ <stFnt:versionString>1.0 2007-02-14</stFnt:versionString>
+ <stFnt:composite>False</stFnt:composite>
+ <stFnt:fontFileName>OldNewspaperTypes.ttf</stFnt:fontFileName>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <stFnt:fontName>Perpetua</stFnt:fontName>
+ <stFnt:fontFamily>Perpetua</stFnt:fontFamily>
+ <stFnt:fontFace>Regular</stFnt:fontFace>
+ <stFnt:fontType>Open Type</stFnt:fontType>
+ <stFnt:versionString>Version 1.76</stFnt:versionString>
+ <stFnt:composite>False</stFnt:composite>
+ <stFnt:fontFileName>Perpetua.ttf</stFnt:fontFileName>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <stFnt:fontName>SmothBight</stFnt:fontName>
+ <stFnt:fontFamily>Smoth Bight</stFnt:fontFamily>
+ <stFnt:fontFace>Regular</stFnt:fontFace>
+ <stFnt:fontType>Open Type</stFnt:fontType>
+ <stFnt:versionString>Version 1.00 (Kustren)</stFnt:versionString>
+ <stFnt:composite>False</stFnt:composite>
+ <stFnt:fontFileName>Smoth-Bight - Por Kustren.otf</stFnt:fontFileName>
+ </rdf:li>
+ </rdf:Bag>
+ </xmpTPg:Fonts>
+ <xmpTPg:PlateNames>
+ <rdf:Seq>
+ <rdf:li>Cyan</rdf:li>
+ <rdf:li>Magenta</rdf:li>
+ <rdf:li>Yellow</rdf:li>
+ <rdf:li>Black</rdf:li>
+ </rdf:Seq>
+ </xmpTPg:PlateNames>
+ <xmpTPg:SwatchGroups>
+ <rdf:Seq>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:groupName>Groupe de nuances par défaut</xmpG:groupName>
+ <xmpG:groupType>0</xmpG:groupType>
+ <xmpG:Colorants>
+ <rdf:Seq>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>Blanc</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>255</xmpG:red>
+ <xmpG:green>255</xmpG:green>
+ <xmpG:blue>255</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>Noir</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>0</xmpG:red>
+ <xmpG:green>0</xmpG:green>
+ <xmpG:blue>0</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>Rouge RVB</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>255</xmpG:red>
+ <xmpG:green>0</xmpG:green>
+ <xmpG:blue>0</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>Jaune RVB</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>255</xmpG:red>
+ <xmpG:green>255</xmpG:green>
+ <xmpG:blue>0</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>Vert RVB</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>0</xmpG:red>
+ <xmpG:green>255</xmpG:green>
+ <xmpG:blue>0</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>Cyan RVB</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>0</xmpG:red>
+ <xmpG:green>255</xmpG:green>
+ <xmpG:blue>255</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>Bleu RVB</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>0</xmpG:red>
+ <xmpG:green>0</xmpG:green>
+ <xmpG:blue>255</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>Magenta RVB</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>255</xmpG:red>
+ <xmpG:green>0</xmpG:green>
+ <xmpG:blue>255</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=193 V=39 B=45</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>193</xmpG:red>
+ <xmpG:green>39</xmpG:green>
+ <xmpG:blue>45</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=237 V=28 B=36</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>237</xmpG:red>
+ <xmpG:green>28</xmpG:green>
+ <xmpG:blue>36</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=241 V=90 B=36</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>241</xmpG:red>
+ <xmpG:green>90</xmpG:green>
+ <xmpG:blue>36</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=247 V=147 B=30</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>247</xmpG:red>
+ <xmpG:green>147</xmpG:green>
+ <xmpG:blue>30</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=251 V=176 B=59</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>251</xmpG:red>
+ <xmpG:green>176</xmpG:green>
+ <xmpG:blue>59</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=252 V=238 B=33</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>252</xmpG:red>
+ <xmpG:green>238</xmpG:green>
+ <xmpG:blue>33</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=217 V=224 B=33</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>217</xmpG:red>
+ <xmpG:green>224</xmpG:green>
+ <xmpG:blue>33</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=140 V=198 B=63</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>140</xmpG:red>
+ <xmpG:green>198</xmpG:green>
+ <xmpG:blue>63</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=57 V=181 B=74</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>57</xmpG:red>
+ <xmpG:green>181</xmpG:green>
+ <xmpG:blue>74</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=0 V=146 B=69</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>0</xmpG:red>
+ <xmpG:green>146</xmpG:green>
+ <xmpG:blue>69</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=0 V=104 B=55</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>0</xmpG:red>
+ <xmpG:green>104</xmpG:green>
+ <xmpG:blue>55</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=34 V=181 B=115</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>34</xmpG:red>
+ <xmpG:green>181</xmpG:green>
+ <xmpG:blue>115</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=0 V=69 B=157</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>0</xmpG:red>
+ <xmpG:green>169</xmpG:green>
+ <xmpG:blue>157</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=41 V=71 B=226</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>41</xmpG:red>
+ <xmpG:green>171</xmpG:green>
+ <xmpG:blue>226</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=0 V=113 B=188</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>0</xmpG:red>
+ <xmpG:green>113</xmpG:green>
+ <xmpG:blue>188</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=46 V=49 B=146</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>46</xmpG:red>
+ <xmpG:green>49</xmpG:green>
+ <xmpG:blue>146</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=27 V=20 B=100</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>27</xmpG:red>
+ <xmpG:green>20</xmpG:green>
+ <xmpG:blue>100</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=102 V=45 B=145</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>102</xmpG:red>
+ <xmpG:green>45</xmpG:green>
+ <xmpG:blue>145</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=147 V=39 B=143</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>147</xmpG:red>
+ <xmpG:green>39</xmpG:green>
+ <xmpG:blue>143</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=158 V=0 B=93</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>158</xmpG:red>
+ <xmpG:green>0</xmpG:green>
+ <xmpG:blue>93</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=212 V=20 B=90</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>212</xmpG:red>
+ <xmpG:green>20</xmpG:green>
+ <xmpG:blue>90</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=237 V=30 B=121</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>237</xmpG:red>
+ <xmpG:green>30</xmpG:green>
+ <xmpG:blue>121</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=199 V=178 B=153</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>199</xmpG:red>
+ <xmpG:green>178</xmpG:green>
+ <xmpG:blue>153</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=153 V=134 B=117</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>153</xmpG:red>
+ <xmpG:green>134</xmpG:green>
+ <xmpG:blue>117</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=115 V=99 B=87</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>115</xmpG:red>
+ <xmpG:green>99</xmpG:green>
+ <xmpG:blue>87</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=83 V=71 B=65</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>83</xmpG:red>
+ <xmpG:green>71</xmpG:green>
+ <xmpG:blue>65</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=198 V=156 B=109</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>198</xmpG:red>
+ <xmpG:green>156</xmpG:green>
+ <xmpG:blue>109</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=166 V=124 B=82</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>166</xmpG:red>
+ <xmpG:green>124</xmpG:green>
+ <xmpG:blue>82</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=140 V=98 B=57</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>140</xmpG:red>
+ <xmpG:green>98</xmpG:green>
+ <xmpG:blue>57</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=117 V=76 B=36</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>117</xmpG:red>
+ <xmpG:green>76</xmpG:green>
+ <xmpG:blue>36</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=96 V=56 B=19</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>96</xmpG:red>
+ <xmpG:green>56</xmpG:green>
+ <xmpG:blue>19</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=66 V=33 B=11</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>66</xmpG:red>
+ <xmpG:green>33</xmpG:green>
+ <xmpG:blue>11</xmpG:blue>
+ </rdf:li>
+ </rdf:Seq>
+ </xmpG:Colorants>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:groupName>Gris</xmpG:groupName>
+ <xmpG:groupType>1</xmpG:groupType>
+ <xmpG:Colorants>
+ <rdf:Seq>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=0 V=0 B=0</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>0</xmpG:red>
+ <xmpG:green>0</xmpG:green>
+ <xmpG:blue>0</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=26 V=26 B=26</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>26</xmpG:red>
+ <xmpG:green>26</xmpG:green>
+ <xmpG:blue>26</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=51 V=51 B=51</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>51</xmpG:red>
+ <xmpG:green>51</xmpG:green>
+ <xmpG:blue>51</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=77 V=77 B=77</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>77</xmpG:red>
+ <xmpG:green>77</xmpG:green>
+ <xmpG:blue>77</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=102 V=102 B=102</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>102</xmpG:red>
+ <xmpG:green>102</xmpG:green>
+ <xmpG:blue>102</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=128 V=128 B=128</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>128</xmpG:red>
+ <xmpG:green>128</xmpG:green>
+ <xmpG:blue>128</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=153 V=153 B=153</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>153</xmpG:red>
+ <xmpG:green>153</xmpG:green>
+ <xmpG:blue>153</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=179 V=179 B=179</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>179</xmpG:red>
+ <xmpG:green>179</xmpG:green>
+ <xmpG:blue>179</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=204 V=204 B=204</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>204</xmpG:red>
+ <xmpG:green>204</xmpG:green>
+ <xmpG:blue>204</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=230 V=230 B=230</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>230</xmpG:red>
+ <xmpG:green>230</xmpG:green>
+ <xmpG:blue>230</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=242 V=242 B=242</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>242</xmpG:red>
+ <xmpG:green>242</xmpG:green>
+ <xmpG:blue>242</xmpG:blue>
+ </rdf:li>
+ </rdf:Seq>
+ </xmpG:Colorants>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:groupName>Groupe de couleurs pour films et vidéos</xmpG:groupName>
+ <xmpG:groupType>1</xmpG:groupType>
+ <xmpG:Colorants>
+ <rdf:Seq>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=123 V=112 B=49</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>123</xmpG:red>
+ <xmpG:green>112</xmpG:green>
+ <xmpG:blue>49</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=199 V=163 B=21</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>199</xmpG:red>
+ <xmpG:green>163</xmpG:green>
+ <xmpG:blue>21</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=182 V=165 B=85</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>182</xmpG:red>
+ <xmpG:green>165</xmpG:green>
+ <xmpG:blue>85</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=235 V=208 B=101</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>235</xmpG:red>
+ <xmpG:green>208</xmpG:green>
+ <xmpG:blue>101</xmpG:blue>
+ </rdf:li>
+ <rdf:li rdf:parseType="Resource">
+ <xmpG:swatchName>R=122 V=111 B=185</xmpG:swatchName>
+ <xmpG:mode>RGB</xmpG:mode>
+ <xmpG:type>PROCESS</xmpG:type>
+ <xmpG:red>122</xmpG:red>
+ <xmpG:green>111</xmpG:green>
+ <xmpG:blue>185</xmpG:blue>
+ </rdf:li>
+ </rdf:Seq>
+ </xmpG:Colorants>
+ </rdf:li>
+ </rdf:Seq>
+ </xmpTPg:SwatchGroups>
+ </rdf:Description>
+ <rdf:Description rdf:about=""
+ xmlns:pdf="http://ns.adobe.com/pdf/1.3/">
+ <pdf:Producer>Adobe PDF library 10.01</pdf:Producer>
+ </rdf:Description>
+ </rdf:RDF>
+</x:xmpmeta>
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+<?xpacket end="w"?> endstream endobj 3 0 obj <</Count 2/Kids[7 0 R 8 0 R]/Type/Pages>> endobj 7 0 obj <</ArtBox[224.515 66.2373 1617.31 1080.0]/BleedBox[0.0 0.0 1920.0 1080.0]/Contents 732 0 R/Group 733 0 R/LastModified(D:20140918115258+02'00')/MediaBox[0.0 0.0 1920.0 1080.0]/Parent 3 0 R/PieceInfo<</Illustrator 734 0 R>>/Resources<</ColorSpace<</CS0 735 0 R/CS1 736 0 R/CS2 737 0 R/CS3 738 0 R/CS4 739 0 R/CS5 740 0 R/CS6 741 0 R/CS7 742 0 R/CS8 743 0 R>>/ExtGState<</GS0 744 0 R/GS1 745 0 R/GS2 746 0 R/GS3 747 0 R/GS4 748 0 R/GS5 749 0 R/GS6 750 0 R/GS7 751 0 R>>/Font<</T1_0 752 0 R/TT0 753 0 R/TT1 754 0 R>>/ProcSet[/PDF/Text/ImageC/ImageI]/Properties<</MC0 730 0 R>>/Shading<</Sh0 755 0 R>>/XObject<</Fm0 756 0 R/Fm1 757 0 R/Fm2 758 0 R/Fm3 759 0 R/Fm4 760 0 R/Fm5 761 0 R/Fm6 762 0 R/Im0 763 0 R/Im1 764 0 R/Im2 765 0 R/Im3 766 0 R/Im4 763 0 R/Im5 767 0 R/Im6 768 0 R/Im7 769 0 R/Im8 770 0 R/Im9 771 0 R>>>>/TrimBox[0.0 0.0 1920.0 1080.0]/Type/Page>> endobj 8 0 obj <</ArtBox[6464.01 6726.74 7856.81 7766.5]/BleedBox[0.0 0.0 14400.0 14400.0]/Contents 772 0 R/Group 773 0 R/LastModified(D:20140918115258+02'00')/MediaBox[0.0 0.0 14400.0 14400.0]/Parent 3 0 R/PieceInfo<</Illustrator 734 0 R>>/Resources<</ColorSpace<</CS0 735 0 R/CS1 736 0 R/CS2 737 0 R/CS3 738 0 R/CS4 739 0 R/CS5 740 0 R/CS6 741 0 R/CS7 742 0 R/CS8 743 0 R>>/ExtGState<</GS0 744 0 R/GS1 745 0 R/GS2 774 0 R/GS3 747 0 R/GS4 775 0 R/GS5 776 0 R/GS6 777 0 R/GS7 778 0 R>>/Font<</T1_0 752 0 R/TT0 753 0 R/TT1 754 0 R>>/ProcSet[/PDF/Text/ImageC/ImageI]/Properties<</MC0 730 0 R>>/Shading<</Sh0 755 0 R>>/XObject<</Fm0 779 0 R/Fm1 780 0 R/Fm2 781 0 R/Fm3 782 0 R/Fm4 783 0 R/Fm5 784 0 R/Fm6 785 0 R/Im0 763 0 R/Im1 764 0 R/Im2 765 0 R/Im3 766 0 R/Im4 763 0 R/Im5 767 0 R/Im6 768 0 R/Im7 769 0 R/Im8 770 0 R/Im9 771 0 R>>>>/TrimBox[0.0 0.0 14400.0 14400.0]/Type/Page>> endobj 772 0 obj <</Filter/FlateDecode/Length 3434>>stream
+Hԗ[o%WWiqA`K\Ϸt&y
+sNuWZU7޽MW7]߸`)ΡG->ٻ1૫-N5eS[7ɻ?-<`O? {W?ӯTKD]%%5w璛5yZDⓜcε\v7
+_:Z{:.`nQ,6fE-Msx,/51*1y2B
+w:
+cqb;O/_=w^
+?zaaLfҜ{8e8!W,!?PO9y L뗸K)<oJaj:H.?mX
+貟+'PU#om%9(4)uH# +S"/|]yx2zRy3Ѱ\C[rƴ)7չFVC;u6-;: Ҫm
+
+χ!LzD[HK߬H!
++1Cɐ*-<5&]a5/,
+4>/c,k y3Ez{ՄMIiE6޺-p] N+N!:HF,RC,)!U]aW :V g;+WtHu<j8%ےbTţ KZ0EgA ] ),2IۄÝ :9QuIaB^a`X;*-nmw
+__)δ TY^ &vypJOSҟNI)߷G񿻹|vܷn`&k &75Ћ,,ۃ6/+D`X3욹5i:0BH6'53R'Y⋻Otw6^hӋOqܖ }g]]xw~pQ=-yyTY CֳĠp yと.n Fͩ q>w`u߾ު/3 wƒnIrūF:O WGWNgh=活{z7o o5Qp;|B̭{ 4tV]Z.ytP߀z
+wH.lO^_^7[)@#IKuxZv䒪w˥ǵ IbeߍuhO?5%mo
+9 XϜǽ
+ym$1ڽ"dJ~#w2J +nn)|ѐʟ PDoO$ lOpsfnBHexWumDѧ.nWMe#ɭcx=OAA<be՜OBI<WBj1VTqP)l6j2_[zUpv!
+2$?ܦEʰ(=DE84fd|WuKs8deZ};bf ),G#+2OJ}u)vonR QX; N"IŒRJ!=:hj @jua2j;.5A7JO^Uؾ\[jp_)K
+ ",p2U? G cAlp^0lw9U4^Kel.Fh)O|#}[tg{(NƹN6.U1Y*j+~e"#z-+VB taψ;/hqHA#+q=uaO"pְd#6P|9XhVY&`ٺ\#ž/$rː*fJO~j~>`U4T OIZĶ8|%]2(.%.c
+q
+/GS0 gs
+486 0 0 480 6513.1162109 7207.1401367 cm
+/Im0 Do
+Q
+ endstream endobj 780 0 obj <</BBox[6557.12 7644.14 6955.12 7246.14]/Group 791 0 R/Length 61/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ColorSpace<</CS0 788 0 R>>/ExtGState<</GS0 792 0 R>>/ProcSet[/PDF/ImageC/ImageI]/XObject<</Im0 793 0 R>>>>/Subtype/Form>>stream
+q
+/GS0 gs
+398 0 0 398 6557.1162109 7246.1401367 cm
+/Im0 Do
+Q
+ endstream endobj 781 0 obj <</BBox[6625.12 7519.14 6893.12 7475.14]/Group 794 0 R/Length 60/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ColorSpace<</CS0 788 0 R>>/ExtGState<</GS0 795 0 R>>/ProcSet[/PDF/ImageC/ImageI]/XObject<</Im0 796 0 R>>>>/Subtype/Form>>stream
+q
+/GS0 gs
+268 0 0 44 6625.1162109 7475.1401367 cm
+/Im0 Do
+Q
+ endstream endobj 782 0 obj <</BBox[6622.12 7549.14 6896.12 7246.14]/Group 797 0 R/Length 61/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ColorSpace<</CS0 788 0 R>>/ExtGState<</GS0 798 0 R>>/ProcSet[/PDF/ImageC/ImageI]/XObject<</Im0 799 0 R>>>>/Subtype/Form>>stream
+q
+/GS0 gs
+274 0 0 303 6622.1162109 7246.1401367 cm
+/Im0 Do
+Q
+ endstream endobj 783 0 obj <</BBox[6647.5 7607.5 6943.5 7516.5]/Group 800 0 R/Length 48/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ColorSpace<</CS0 788 0 R>>/ExtGState<</GS0 801 0 R>>/ProcSet[/PDF/ImageC/ImageI]/XObject<</Im0 802 0 R>>>>/Subtype/Form>>stream
+q
+/GS0 gs
+296 0 0 91 6647.5 7516.5 cm
+/Im0 Do
+Q
+ endstream endobj 784 0 obj <</BBox[6485.5 7766.5 6957.5 7240.5]/Group 803 0 R/Length 49/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ColorSpace<</CS0 788 0 R>>/ExtGState<</GS0 804 0 R>>/ProcSet[/PDF/ImageC/ImageI]/XObject<</Im0 805 0 R>>>>/Subtype/Form>>stream
+q
+/GS0 gs
+472 0 0 526 6485.5 7240.5 cm
+/Im0 Do
+Q
+ endstream endobj 785 0 obj <</BBox[6522.5 7682.5 7035.5 7180.5]/Group 806 0 R/Length 49/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ColorSpace<</CS0 788 0 R>>/ExtGState<</GS0 807 0 R>>/ProcSet[/PDF/ImageC/ImageI]/XObject<</Im0 808 0 R>>>>/Subtype/Form>>stream
+q
+/GS0 gs
+513 0 0 502 6522.5 7180.5 cm
+/Im0 Do
+Q
+ endstream endobj 763 0 obj <</BitsPerComponent 8/ColorSpace 736 0 R/Decode[0.0 255.0]/Filter/FlateDecode/Height 87/Intent/RelativeColorimetric/Length 321/Name/X/SMask 809 0 R/Subtype/Image/Type/XObject/Width 310>>stream
+HgN@@uޝad"xVzj
+slBXiniYBru\(N[m.LCN~ݬ_֛n840-!+b-7NӴIEWLn5ql_l˯6t^QETPc`PO՞诪
+Hg{Jc6'9 Lw
+jH!T2#Wu\dt3           }? ^ؽ>{}`s3fz~p?xxv/^zkZ욣f(uP6ʲ$vf~{iv] N 0Ʒ)v8XL c<麆RPQd$ <q,0>Mӽ^ ˋfXTW3
+c>vڭf^Vʥb!fJ&s$>yƓTb;'gL]7JY*GA(x"t&rZ7v"BUSjz9w,$Pcˋ|x;.n *opԙ/NsXүRD,^_~ݿ?/..>]=>4l{S7`yHʕj+ϝ'GGD4SժL*y|-U`58;cM+phSu4uQÞ>YܝjLJC CC2ߴ!_ FSkTMgOofb#M{?-3-lmd8 M;)*S쾬4Fl}O1n>w~KƟeaX{Zw~=ې)'Vv?!t١ F= !5ʕ[ 'Ṿ-ڈ5Ն͊N$Lef{
+=kr\y=]<;15FtDn׳&
+NC1޴rcӳмl v'y%vr^XF@/؝Smh_>_f ܳ7 7Բw嬽f#zϗ?myKVDD[z v"wv,&n@6}r_ϴ;h!;,Uv_Y1*C7X wj"+Do^:k 휩c9/YGAv''Ʀ=`;1;Ұ$JDO!"v]r =UX3 vY6r@ zC͘ 얳)XnWoq{N*9ާMcv4rDOLgvHXeX')>lVDE,'ʚv/tۆ& XO9:Y* ݣ@R
+;ͦc^Gxq8B<;ۍrNq``皺<`\!z@LV<ڭ6cxY8`h7$Zsj]m"KcfIhVvCaFAz.+~kuvvӑ,Wֈ^e}
+vv˩.s6VD$m
+F`G;[/\ʧ/;:ۀYG;S+\*"zb͂]LeB%I-T[vL`D<A2Jvvvٰ,X.tܠ;эRŢ1^T] QGe]VHs҅jSSI, G^Wڲ vڕr^X/A- [;rMʼnܓO/ʖ:5Kd ==>X2Sl]-5D=^4.Ekvg*B!5 vky*rD/rUa
+va\*J}zT^hgj6rwwD/T`e',w{sK"4ؽn:G,w=T7`wb|1{_OX5{xJ܂i.x>]}"zI{JH]]^P$Qd' ; %X>`BvixnN%k8\noww Iq/>0٭Ozk\0˥!" ESYihx&#AzD/Ifh7e
+rzYXi턍- ꈞŎv VJ1 rZmhq xYM QkɊvNQrj-HavS)UD`F;X结Be҃R$zz+_ܢ1;rN]g1v 'ɉ oЎ߸dRӠxCB.ЫAN*=q;I$DOvvO7٠]9+S,Sx#v&`Anfzɵ6uvxvNniv=^~Frl'X}ts
+ܯ1=AYRѓ-ػ쿠/'ON>lhwߠ)J2ӛT;{Cv#߾_b{eRαtCo_X9ɛ\Ўߤ+WVKr#ܗ/oVa$g%fej響/h VN51g8
+X[bJ(z r{Pvȹ=^_=^n舟x@<^}D=RT vbmӱ"zDctmv]<@qz G8ډ5idz ‰t}]6 r@0̠HCf. r`(6vn"ӱp0H8`(sh'kzUP@.|s
+턁]1àrH4.HCv)E"rh,)N1T<=l Dz;grt"=ti_?A;~`Wx@.Hykdw{P)S\"J7h' L%StXA;v/wGRN@R4-Un"34M15x3(Nt&nNg,4\:-Kh7Ҫs \&+Vw/h'[mWKl@.˗lhzY1\qr|W;h7gPg<\Pdkh7dcQ.
+rbXXܣ0nsYaEb47n]tkUeJ%T[K'h'^i #rL^BɆvoze
+×{s{a;LwHj| u4({U[^^׷b:%kr
+=ȽO;ͥTct=ȽNz6~G`Wy' 7O曣T{b:Crt={աzLg˝bj"Gۯ) 7W{Վh';^fЃlX4'{]YЃ|u'{iZ,r=n\.Me^.jS /Tc߬VЃj٫N
+vvخЃz=hV@;. lvw ;.r~䶻pB=.yavb8QN;Ʈ=S=ЃpTM7*h';N w84ˋi'ؕI`=OnqI;. C=N=Ui@r Zek
+=ȩn!<4AN ˋJ:}uAN7 ۏvR[]āc^'gN紓kE8j g+7=ڕiڦ =ș "ϱ,Aβ/JK5v1cЃ8NYNOrYE;9q Vr}iܽ=$]zs=?L4].σ<?Ң\k1Cr~@oH0A.=Qhvbh#A.# ډM0(SA:"Nh;]i=E1#̒8ʺ9ivbhSA.NRaw\gWi@rI@8R,A.
+ ˧ fv7uvug==e
+ Է+T,/h7Xy=nchˢSA,]?؉?A zʪꦂvzv:7]uӃ\UwSA~]7;˹5~diׯgwE{.W vٹڣ]٥vpk7~qTn|ۏ~qTyyyc1c1c1c1c1cO
+HI
+Hҹ0Plc@ P
+kku.`A| i
+H{_t:if3q ."&"?#i~oaaaaaaaaaaa/Cv/^ڽ<{yyo~?۷ݒ?h;r߱Kfٜ|;^l.zɕ9I}K҂dsE2M˴z2c"^جWK{nNHO۶%Η9c|wnvϳ!*\LӦxe4e$!DZ`0>Mӽ^̀$U3=swZ΍",|9@aA/HQ'iA=AvO;Z)eDDrӽnj6j\*l&MQd"F"ch,r@z2~֎tAᇇAQdҙl._(ʕjhڝnϹ=,7*Xn6a]/&v(rۛϟ>^~_]8Z-ܯPx,t?|/.>\~.t)̩bu{U=3^a9Hʕj+^>O/O%br|"_Jydpk}|MjctX(Vf-,'6TH% }|@SɴǑUW\{\9w]iLSt2ɞš
+4U[s^suQve[nwDm|7-aWl)/ى
+f)€f zi|݈gz ר7@ 婉vvT WA礉vvDժ5Ь4Fvkc,6U+UkNWArrZ]F@N`:M+ʠyezBv3 W*@Ѧ# VhH W,Aq2\YB
+E#QKtKjJ\$$E |vJJΥV9{r^<)55K#=?c2]l]@;KlӉ݇A/
+uܠy]@ţ  ^4NkhNށ^1 vT̓blmLMF ws}zh"SeH<vAa%߃+л?R%V_y`G=C g chю+S;=DSŁ~B.A>Dvk-%#p z7pVhw%w ]߅hC8`vד䜳D"#298"mU#շ30qp,o_X`KEC녢,ډշ{id Q^
+Dv]&@8F;vt<9zPn^tNo @r/E;jL4˹.^/IU6λh'is:Gh'Z߮{Ye>
+vQPv! rvtD^Tj=Hkgh7o gXAMNrul=gW_No8Al2Ch56A g2@c_wh'le9zvvqv/glr@Π7On!;:=Yh'^J)[@NՁNnn!;-mh'tXM Qk@dumkb9J zF ډ=ߞ,"nTJ̮Pn}v†LzS*7x=b>2@N!W f珯Nа29i h'^ 9 Ie;#kN rY)nB|6Ы@nvfT:?:<hvJ=%Mh`w4 u
+LBk1kNJ$?%'G qvVoA4Vi_;^vٽ>vϪ܏?@OЩeF#r߿}'zh7~-j}IfUf*YٽHB/_zhqv˽z6f9ܗ_z=ɛ\<q;NϜg=n-I3ܧO^oZa+h7ݧ>[_.v Q1M"x+oG;AFow]{ r OSwEͳ;x~<>ُ=^7ڢJ8^_̪T{E;AB?z}Mo9h2>F6 ~Jj Hv.'F;ߦ̀i4ؿz|EFfgywYgt}4 u
+T*|LvFd2)#r2&4;z\zDN.WtS)G
+M{i/BNZ="T@f FӨTGT* Mow^̇]FZ zDN1ڍ5lh@i4:#ډ׳|{TMzV7B3 3t:#r:vqv/wŨbAF;_lߢ!;`
+Pn vvArs<t
+b: AȅS@;vsL2DbtyB;a`fSh\4OeJh'ֻ<cX,d^ rIG$C;v7 B:HK$R|yn턁]aI#r$)TNbeR)#r-Vn<4Εj h'һRgdl}"vr!NKv" +J1ɀdrrsչj)͂fJkD۽޵kl!r[[=FB-G"[_C;v'rP
+˂cJ}ne"vk j zD\6WwN]lo}YT@U*ڍE7Zj\Zo-ݿrJsRΉ`n]w*SO!%^^:Vm4(NqN-ﯯGrV]Hcin AdgV;h밓q=|}|gnXk|2ɍFhewlHn<.6'3`7luM&GrlU,a:tj>MNa'\^fGrbלv8n9|t7^k{iZ,XhN[/Grzw2ݠ. ,uYXV^1}IjRakzz$^o$v~m6Gr"ݰ. ]nYIwDz \S9vGrA10ݰ%<S=GrQ5vZ"-t8'v.uxd=;vZ2NGrjd]*\SS#9ELG$vZ* ]SWU#9UMWVYYiaaZnXgۦi{QV]a78pL`=3 a'awX鱜iAװڝDiə트oDvezeY㉤8nXgmٶi ;Iݥ8Gri9b==s=ь 솱] uY\q֮ư{N ^y^9duvi$|HEzsЊ `= v%%C#9͘$km$둜QъȮIGra%Y;Y]QrQ)X>
+IRfI#8Ɋvخiqή$a=K4vO]Y#4+*Ic˗;I]]YO䲼1 vEeYQְvͰ(H.ϋ
+vsЖEO䊲͎Haw$k>xU#a'ܧ`T\UUv:빮zz$ea'o`ܧv\7~[£vO쮗s}5]vOݟ:S vvWqۣSu.iVwy7Ͽ}ڿ?oo;B!B!B!B!B!
+H 
+H 0Qְ+Qs@+`䓋
+vG_
+H΁@
+H z--JRMX49jV&""""""ڟŇSrM'crfG
+'3ݞ<SSvA[*^HL+{,[Uw;лƔ0WL9E@}S T&"""""
+Hͱ
+tttlllfffaaaZZZTTTOOOJJJDDD???;;;555222---)))!!! 
+HyTSwoɞc [5laQIBHADED2mtFOE.c}08׎8GNg9w߽
+ 
+V)gB0iW8#8wթ8_٥ʨQQj@&A)/g>'K
+x-
+ꇆnQt}MA0alSx k&^>0|>_',G!"F$H:R!zFQd?r 9\A&G rQ hE]a4zBgE#H *B=0HIpp0MxJ$D1D, VĭKĻYdE"EI2EBGt4MzNr!YK ?%_&#(0J:EAiQ(()ӔWT6U@P+!~mD eԴ!hӦh/']B/ҏӿ?a0nhF!X8܌kc&5S6lIa2cKMA!E#ƒdV(kel }}Cq9
+N')].uJr
+ wG xR^[oƜchg`>b$*~ :Eb~,m,-ݖ,Y¬*6X[ݱF=3뭷Y~dó ti zf6~`{v.Ng#{}}jc1X6fm;'_9 r:8q:˜O:ϸ8uJqnv=MmR 4
+n3ܣkGݯz=[==<=G</z^^j^ ޡZQB0FX'+t<u-{__ߘ-G,}/Hh 8mW2p[AiAN#8$X?AKHI{!7<qWy(!46-aaaW @@`lYĎH,$((Yh7ъb<b*b<~L&Y&9%uMssNpJP%MI JlN<DHJIڐtCj'KwKgC%Nd |ꙪO=%mLuvx:HoL!ȨC&13#s$/Y=OsbsrnsO1v=ˏϟ\h٢#¼oZ<]TUt}`IÒsKV-Y,+>TB(/S,]6*-W:#7*e^YDY}UjAyT`#D="b{ų+ʯ:!kJ4Gmt}uC%K7YVfFY .=b?SƕƩȺy چ k5%4m7lqlioZlG+Zz͹mzy]?uuw|"űNwW&e֥ﺱ*|j5kyݭǯg^ykEklD_p߶7Dmo꿻1ml{Mś nLl<9O
+zpg_XQKFAǿ=ȼ:ɹ8ʷ6˶5̵5͵6ζ7ϸ9к<Ѿ?DINU\dlvۀ܊ݖޢ)߯6DScs 2F[p(@Xr4Pm8Ww)Km
+H
+}}}tttlll^^^PPPCCC222((( 
+H1
+bbb[[[III444///+++###
+
+
+
+HA
+tttlllPPPJJJ222(((  endstream endobj 737 0 obj [/Indexed 735 0 R 121 823 0 R] endobj 813 0 obj <</BitsPerComponent 8/ColorSpace/DeviceGray/DecodeParms<</BitsPerComponent 4/Colors 1/Columns 316>>/Filter/FlateDecode/Height 345/Intent/RelativeColorimetric/Length 604/Name/X/Subtype/Image/Type/XObject/Width 316>>stream
+HA
+}}}{{{yyywwwvvvtttqqqpppnnnlllkkkhhhgggeeebbb___^^^\\\ZZZYYYWWWVVVTTTRRRQQQOOONNNLLLJJJHHHFFFEEECCCBBB@@@???>>><<<:::888777555444333222111///...---,,,+++)))((('''&&&%%%$$$###"""!!! 
+
+
+ 
+H̡
+rrrkkkWWWPPP???444///+++&&&""" 
+H1
+|||tttMMM@@@***!!! endstream endobj 810 0 obj <</BitsPerComponent 8/ColorSpace/DeviceGray/DecodeParms<</BitsPerComponent 4/Colors 1/Columns 316>>/Filter/FlateDecode/Height 345/Intent/RelativeColorimetric/Length 603/Name/X/Subtype/Image/Type/XObject/Width 316>>stream
+H
+H1
+kZaVX+
+kZa
+~~~wwwpppiiibbb\\\VVVQQQKKKFFF@@@<<<666222---)))%%%!!!
+
+
+
+HnFE/ b-Q Ϋ
+Hvv0< @ Ivot".V[
+c$
+Q _?c'I>jޟ?6S<?/EDƟLәL:J&T |,{>mT&ˋ\_sGe|TB^EHT\_zZ)T $
+К
+`<<Q`r|
+Tkcs:M:F\)
+'*hf9ﻎ5[RN  WZsa; +@
+p$FotA[-S
+W\7@:_mgkw<9)_'~=w%P&@c'<rRz)v
+@[0_
+Q噤8Eᨩ*0{d@B$6ǻy=#:*'dĹyLe
+4{4tCoȟOi
+
+^ʘ
+GL N$_Y}5
+rR)Z;(s^Ԕɰ Nƣa4
+O?o,o}] 0܃q׶uJ
+&|՟̌߀/oo/O\gihP
+,
+R5`9||~<ǘInTY6@HK@IR.`/ vmiLO N(/@ =<==7@TCa?ř_Y8h׊PT?G0L|b;]ms8Q0'>$
+<I'tP˪zE
+ Y
+ k! (rV4M(Xb@끅 4( _Bx%hbfTk*^D_Pub6@4%IE~_[UXb8 O!{
+l
+?-2Y>}`򉼦owzvqz '|o~  
+o S\:$I($eR
+k5;V#z:ڭ&å|}{A{fXt2mNpa6X$;ՙ{>
+{O39O2}+TbB}]k^p<<b9n%:Na#vZgR>/t0u;;wf9slۦm[Te_$d
+@}g<E+p
+`LWg0N I>
+$h
+'oiz26t*^X4B_/.a
+_`DgӢςHX6x|}]
+
+q
+/GS0 gs
+513 0 0 502 6522.5 7180.5 cm
+/Im0 Do
+Q
+ endstream endobj 832 0 obj <</CS 735 0 R/I false/K false/S/Transparency/Type/Group>> endobj 833 0 obj <</BitsPerComponent 8/ColorSpace/DeviceGray/DecodeParms<</BitsPerComponent 4/Colors 1/Columns 513>>/Filter/FlateDecode/Height 502/Intent/RelativeColorimetric/Length 8911/Name/X/Subtype/Image/Type/XObject/Width 513>>stream
+Hvv0< @ Ivot".V[
+c$
+Q _?c'I>jޟ?6S<?/EDƟLәL:J&T |,{>mT&ˋ\_sGe|TB^EHT\_zZ)T $
+К
+`<<Q`r|
+Tkcs:M:F\)
+'*hf9ﻎ5[RN  WZsa; +@
+p$FotA[-S
+W\7@:_mgkw<9)_'~=w%P&@c'<rRz)v
+@[0_
+Q噤8Eᨩ*0{d@B$6ǻy=#:*'dĹyLe
+4{4tCoȟOi
+
+^ʘ
+GL N$_Y}5
+rR)Z;(s^Ԕɰ Nƣa4
+O?o,o}] 0܃q׶uJ
+&|՟̌߀/oo/O\gihP
+,
+R5`9||~<ǘInTY6@HK@IR.`/ vmiLO N(/@ =<==7@TCa?ř_Y8h׊PT?G0L|b;]ms8Q0'>$
+<I'tP˪zE
+ Y
+ k! (rV4M(Xb@끅 4( _Bx%hbfTk*^D_Pub6@4%IE~_[UXb8 O!{
+l
+?-2Y>}`򉼦owzvqz '|o~  
+o S\:$I($eR
+k5;V#z:ڭ&å|}{A{fXt2mNpa6X$;ՙ{>
+{O39O2}+TbB}]k^p<<b9n%:Na#vZgR>/t0u;;wf9slۦm[Te_$d
+@}g<E+p
+`LWg0N I>
+$h
+'oiz26t*^X4B_/.a
+_`DgӢςHX6x|}]
+HAnVDA䖚OfTĖ oo
+
+MH'Bz .5.oŮoy/tO~[~F=}o|u3& j]p[]ï҈7` x 7̶a#w_}T=rqg>!pU=iQEA-Q}L&t&t˚>Sd$kYugIV]YUaeuUUuEJ:ªα4SZimV]ڬ!k'Y+Pթ^1Utϯ UŦzUYRd$k'U+INvҵd$k'];ZJNvd$k)Y;INvUuǪʺ Y+ZINVeu ǚʺMuwZINVt$k%k'];IRvҵd$kSYu\UYӵNfu8Y+];INVvd-%k'];IRvҵtk)]KZJNvtk'Y+];IJvҵdk']+INvҵtk'];INVz6{tlV]tV]w|V]7r 8Umʪ.eu꺇Yu݃gu vҵtt8[еtk'];INvҵtk'];INvd$k)Y;IRvҳd-%k+Y[JU
+HviEV$9TE3Bm?̜U!px<=dx l{B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!(|8|4*?3yts"V\!nt~xPN? Jťpqg6O˫kq}}uya%$w^;.r9aʥz$K3hu5W׽RR%egёBK`0=nK_k<;%pk)jz bp'b/d^Y >81k.*Wǒt:@Z)ztA! <(|خ.?OgB.u)b/NG|(A,
+"}o~%'Èk(Η*F\$~NW*[7t&H!yI=S/vzdlju٢JkVbT*҉H+wQUE/U̙ao0)UNY-gaCZ#1Z,fZ5t\U}G+EJ_1}dhtz^iR bVh2jVըV/S˨ (h]Dϥ:44]{Ѱ׮0B SB٨5Z^mլ8;.a2Nsʧ%aPM^v6YYX'ɰ[/g`5KC1j֛p< nf=j<%q\Z>S|vT5g|65+8E`4-Tw}8dzg!@=?U9&A G衉D*\«J`X'|#S8 FrZikk= {Cva|')\.+ET5,ֺ#[L±T\mvzllnWixn5&[{ ղ*RT8 Z>dR|fsRBP.楈SERxZ/gk؏‰lĕ<̗vDM;Jꋋ7|Jzy ?
+#*P[(:hh6jID^O揤KdF mSMJ ^v\MDnܪdehB5e-h<ΈbDhJ]F8=hOW:lD8I\K6.֛aw[&'g*y!.sWn$ 5UDbbVZހѶd2qze+l٬d$Ry3b_T`F1J"aՖ\ݙxDH6֥BJ*VZt:]`KWY,l<C`,k^k4 F$ty+a}~y}}}~a: \fRIHX:dox"B*j;5
+ehu{pda],Wrmnת ~lIM-j! #x!Z^^?V^mJe3T2L=nam'ۉ?
+~]5D/Wi9_V?U^l#~7l*kKsXVETJ~jifVc{uM(}<Y/C۬=LNdmVBdQrV֒˯lUTeb\Kb[*@Q#BǶ(詓*3k aUb:굪 &ǣ&ɨi"{RltQ^
+2_3~Cj90YU~ױoVe8HcDG"lj#͢z
+U07~1Fr'(
+ىa ; aի\*8mv
+6/waVˌ<`jOX,Z>l1r$"AvN
+JR-V*^lҷTw'jkI9{YG泩X~cû}X*WV,P9 1daZy
+8,ޡmݡ[GTT!}vFF4Ɍ'32WIBmԪ$ ֫+(5ĥ@ ۠<%Ѕ +2tfK'/NSXCNZT!E,#OQzB0g- TmT5N%Ѱ^#K堒%4ŢX<A
+S 0ue31`ŜkըӱF {
+XL2Kk7" Q%֥ȥVP^Vc< AYE.Z #H8
+P$Z,RZ3znZ0yCé猅%aݨ2ŀ=qTŒTw;&VQ+ul4z (+e^TDju_[/-{Wpy>^ʖ\
+W&G:z}M&\dn h@[᪸Z)[SY-R9ѧ*qF G+6يZe`PsFڥfR^8.NYC!)ҀUMA%3ڴr=L]
+z8sRk$@jz
+ƹ"QH+حHץpUT.mifi׮z}}@ʪ$PĎ%l' W)an@dJ.-񀘹|: \v)^s2.
+h; UAݬf+5{IZ^^eOT2Մjva{|Ņ\/"LTk0r(0avho&UzL G64)RpȞS7#%OsS ^{Zy0x*tp`(bWԱo,Ei$XӹD C1ݭ6Z\5MzWe/ϳDm\_qfAQWa/,s~0EC`#=nJKU^)i@ ҩ]|ABFU<xQB*2ZT.$V]ݻdUIl*4Ɠ Z&Q`t6cPb|&*j~'z|GU%+]a0l"NBNa
+jcKZ504
+T^]LS5 x r,Ɓc}rUɪZ,!6x[.3q]A%R2U}=3=9$sьѠOXMnZ5]\WXcнmpvlT oQդ>'j/N{LڃeJVAcK߁\>aWɮDs9T_/TA`;C"-R-M\*9S %U*k?M^mV˶ .Knn'sL:KWkj'0H%Xz#jsxx:_Utrb:pd"έJXQMM9+ D~ڠh€:wZJ!э[
+_%~|W<LĚ̕mP%z[ Hud`vZj1T_ogG+uN倵q;V~eD4RU H<3}VKfg8]6v%l<wo[7:k6 .eo*^Q^
+8tZy%Zk4Hk/V<vkۘOvV5MT$^_ 3hKۃ1ǯoƆ
+VKY5O[Ot߮ǭcFVEEV"2d|BRpSout6ە kFfU(JĖJ*M,xA#k%tNFҴ׻z6*Q!E L&u8`D!Bm½x:[,͕Nts64ʪ,9<DV RI8ɰT}|4Lv7~`;Z8&Kg,C$ׯ'u</ 4kYI]׋f3id! Kz 7D
+V&ղ,jM4pƤ)P4J&T:C3l.c?kPg0
++ܭyܭܰlǶWsXx
+ZU]a&p2"x~#'d:B_k*
+0A( @^n#RfA-h \Эu=ϗy%+c_/X NR /^{{z^ֵY%fMo;>2r9f|^uЮH+_}՗1TxUHq\Gzf0qH>+_wJZg4[X#rkVԂwu)dٟp|{1j/ ltbdΉj=ZጭB{MN]W,Z 'ԍ4E|Aw'=^_^ .ƽF(rwd5RfiDDؚ` w+
+պnk1*3Th 2)frp>_P+co׶VKZ v2LN%YVdPpfzEZmvMrDkЭ墦+iV5ZO Nʘz-Њ5%Z kBjzn[F^o:ttCk" ޙ`'/PB\ټU[h<~FӅl~ZL*Np[S"$f 4b>L&Srvj%pPz;z٬]{e(l?pV!,UPMVomzo
+ap<Bztخms>aB`KgwzlqqdЮE5\ ~C`EoWXکO[`X3Na2栵QV%%Z
+,Y^*UÙi:]]2Q]/ӉXh %I,kplqVNh !X4^ &a,ɨm7j"!8*"~`asb\Gt2;zU/)<k}"ZDT%\oV+
+V\6>!iXBĶ:n'0lDkVA+xEDT5&`[Mae"ZÃUd5R*WkZEG~XЀId*ar岯AzDkH+HM$T*Me,"t+ރcODkkEAMS $+ŢRa
+p7d
+tfe
+Cqךq\eˀX!/ycq%Z
+G+E3HV4E0iMi
+UQdnX+kx`N EYGҷ_xZS{\ժeM%Z3J|_YNTJj5UeQTjh TURzvbE8q_sIq, Q]UxF rH jY\ w7D|' ﮠS= R13-2P1Fh,N3n^ [-!XcFD2LRk~+%P`8(6ЩT*L| JMv/{a3^^.dSWVԩ|X*˕Z~&] ,g۬sןd~!"ЩJh4v?b˭t]S,7Z)ND^]1P‘X^%ix2_{E;v5z9Ah" 1MdX ˶-CSn26k<&1CPt6gYnI t:9QE5B'lS9\7~<1ک_$bgjv{Q a=_ΞcDcZ1 _zdqT-=_|_7+_oӟΜdXm6iܳWV3b8Fb=|٣&ZѺzz]/K[ Y_S9T|E`z߮yدĮx /:фоAX9GYXL]J~{ qV~|||m3V80waCag TwΗnqK<;!F]qӬx2xSBPPw] ﯠZFcd:[(_i&hW+os]P1GcD*Jfwpa_`0tԩv%vAG8勥Jg^9AܰtYJ슃5/+zZrS x]@]"]*VjVŘ[oEU7y.`Ռ6]qp\m{ј̹Fhئ4*4+z5+՚L Y7dةD5)T]U6*np̣rJ|]]^dXk[Z;7* 9=hUD슅\!!3_;@* Gz)G^vA˕]m]2, `~h o.zzf+Vױy/!vF_S٣N z}!a=a铉~:vaW
+n{~\osrH 㤗Kfp؆\?>׳K<;z%1돟ȰB \蜯'͜PMKA1Npl&
+9׫gGwQOOjk? ׻2R*Wr3ffyI`]ZφJP$qӃk*_nj_xJYR8*9TTŃy.1-GL^D^~s|%Ⱥ鸮cjfNW!ox*[6{tUݴmSWd*zR/?~&92Jaȳt/\? WX2+!|:U^.ވ;IQUy~b++fz5vԄ]m"ؕ7 vE|DYQ= | \]J3OXHaQVUEڭY+ W0<2:۽>0
+b=ʕ=C/aH (oDPmdzVTuòmda9*a bڵTRV:ܓZ9$a p< Nj.ںstkÄ+Vzp֡fj8]/K9;WpB 7z4K^7Zj:lzS//h$sfYleW@_oS
+qܳgҤ WR^\%t\읬C1\͓zR{գi;mUa\+B\#z'iAV3?rH@Ѣs9$HsmY51 Pvf5՚{6ҒUf9yUOr^Nr:Kyz3k<[|>DԊ*fNx:n=7Z!MW%9HBt U:Ui*FROt\a{JrnTFR_n"3Tmp|z~~z;Gk'/>r ˏorotU*qpo</^^^_U&誖Ϭh"ct+tUNֈRO÷y;rnY2k"/7|ݺn]`/aYӹbֺ>xMΫDWu80,R|}8?ۯCWE|<px2+Vw06ۣ~ihb:y>"t}|~~~ZٰSͧAGDW9X2+DF d:_k59G2kVo4[no02zw8Za2z1cMtUx*[l۝֗av۬f~Ka&u؟WHkT7۝Nj>jZ (5lRƭk,pG9}dLgb1zj!۟W*>X*'⻪ 3OD|65tYɧb!>]O*Xc ;Btr.BDXkixbf3Ӝ)r\Ȯz)DWE]DT SrZVZr^k4+7ylok{
+ZiFr;ÇnO]UsWZ}cdYvotUCk=0t: +y>*ՒUUkx-&y'"jZRy1m6z0֪2quٵ?6kyo֫b3s2{z9>]5_mFӹ|.dbx4vR$!MWU|v45}<5gё>z=MӺVV.dr6)*ޯzČ:fhj\̉V*ޯl*FR.B!fRX8Ǖ/Id
+zIWJQ3-Rd"U5.םSb۷V)iY3
+H8 %쾣:DWW|`|\VŬ
+KV8]x2+/j.GáQ=nɪp
+d:uHH[D#bnIy&
+v.FvH4ć5hgub~&[@0o;*Nta}~~/Wҗp ~II*v{Dۓ_ +fqG֯M
+
+q
+/GS0 gs
+472 0 0 526 6485.5 7240.5 cm
+/Im0 Do
+Q
+ endstream endobj 838 0 obj <</CS 735 0 R/I false/K false/S/Transparency/Type/Group>> endobj 839 0 obj <</BitsPerComponent 8/ColorSpace/DeviceGray/DecodeParms<</BitsPerComponent 4/Colors 1/Columns 472>>/Filter/FlateDecode/Height 526/Intent/RelativeColorimetric/Length 11417/Name/X/Subtype/Image/Type/XObject/Width 472>>stream
+HviEV$9TE3Bm?̜U!px<=dx l{B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!(|8|4*?3yts"V\!nt~xPN? Jťpqg6O˫kq}}uya%$w^;.r9aʥz$K3hu5W׽RR%egёBK`0=nK_k<;%pk)jz bp'b/d^Y >81k.*Wǒt:@Z)ztA! <(|خ.?OgB.u)b/NG|(A,
+"}o~%'Èk(Η*F\$~NW*[7t&H!yI=S/vzdlju٢JkVbT*҉H+wQUE/U̙ao0)UNY-gaCZ#1Z,fZ5t\U}G+EJ_1}dhtz^iR bVh2jVըV/S˨ (h]Dϥ:44]{Ѱ׮0B SB٨5Z^mլ8;.a2Nsʧ%aPM^v6YYX'ɰ[/g`5KC1j֛p< nf=j<%q\Z>S|vT5g|65+8E`4-Tw}8dzg!@=?U9&A G衉D*\«J`X'|#S8 FrZikk= {Cva|')\.+ET5,ֺ#[L±T\mvzllnWixn5&[{ ղ*RT8 Z>dR|fsRBP.楈SERxZ/gk؏‰lĕ<̗vDM;Jꋋ7|Jzy ?
+#*P[(:hh6jID^O揤KdF mSMJ ^v\MDnܪdehB5e-h<ΈbDhJ]F8=hOW:lD8I\K6.֛aw[&'g*y!.sWn$ 5UDbbVZހѶd2qze+l٬d$Ry3b_T`F1J"aՖ\ݙxDH6֥BJ*VZt:]`KWY,l<C`,k^k4 F$ty+a}~y}}}~a: \fRIHX:dox"B*j;5
+ehu{pda],Wrmnת ~lIM-j! #x!Z^^?V^mJe3T2L=nam'ۉ?
+~]5D/Wi9_V?U^l#~7l*kKsXVETJ~jifVc{uM(}<Y/C۬=LNdmVBdQrV֒˯lUTeb\Kb[*@Q#BǶ(詓*3k aUb:굪 &ǣ&ɨi"{RltQ^
+2_3~Cj90YU~ױoVe8HcDG"lj#͢z
+U07~1Fr'(
+ىa ; aի\*8mv
+6/waVˌ<`jOX,Z>l1r$"AvN
+JR-V*^lҷTw'jkI9{YG泩X~cû}X*WV,P9 1daZy
+8,ޡmݡ[GTT!}vFF4Ɍ'32WIBmԪ$ ֫+(5ĥ@ ۠<%Ѕ +2tfK'/NSXCNZT!E,#OQzB0g- TmT5N%Ѱ^#K堒%4ŢX<A
+S 0ue31`ŜkըӱF {
+XL2Kk7" Q%֥ȥVP^Vc< AYE.Z #H8
+P$Z,RZ3znZ0yCé猅%aݨ2ŀ=qTŒTw;&VQ+ul4z (+e^TDju_[/-{Wpy>^ʖ\
+W&G:z}M&\dn h@[᪸Z)[SY-R9ѧ*qF G+6يZe`PsFڥfR^8.NYC!)ҀUMA%3ڴr=L]
+z8sRk$@jz
+ƹ"QH+حHץpUT.mifi׮z}}@ʪ$PĎ%l' W)an@dJ.-񀘹|: \v)^s2.
+h; UAݬf+5{IZ^^eOT2Մjva{|Ņ\/"LTk0r(0avho&UzL G64)RpȞS7#%OsS ^{Zy0x*tp`(bWԱo,Ei$XӹD C1ݭ6Z\5MzWe/ϳDm\_qfAQWa/,s~0EC`#=nJKU^)i@ ҩ]|ABFU<xQB*2ZT.$V]ݻdUIl*4Ɠ Z&Q`t6cPb|&*j~'z|GU%+]a0l"NBNa
+jcKZ504
+T^]LS5 x r,Ɓc}rUɪZ,!6x[.3q]A%R2U}=3=9$sьѠOXMnZ5]\WXcнmpvlT oQդ>'j/N{LڃeJVAcK߁\>aWɮDs9T_/TA`;C"-R-M\*9S %U*k?M^mV˶ .Knn'sL:KWkj'0H%Xz#jsxx:_Utrb:pd"έJXQMM9+ D~ڠh€:wZJ!э[
+_%~|W<LĚ̕mP%z[ Hud`vZj1T_ogG+uN倵q;V~eD4RU H<3}VKfg8]6v%l<wo[7:k6 .eo*^Q^
+8tZy%Zk4Hk/V<vkۘOvV5MT$^_ 3hKۃ1ǯoƆ
+VKY5O[Ot߮ǭcFVEEV"2d|BRpSout6ە kFfU(JĖJ*M,xA#k%tNFҴ׻z6*Q!E L&u8`D!Bm½x:[,͕Nts64ʪ,9<DV RI8ɰT}|4Lv7~`;Z8&Kg,C$ׯ'u</ 4kYI]׋f3id! Kz 7D
+V&ղ,jM4pƤ)P4J&T:C3l.c?kPg0
++ܭyܭܰlǶWsXx
+ZU]a&p2"x~#'d:B_k*
+0A( @^n#RfA-h \Эu=ϗy%+c_/X NR /^{{z^ֵY%fMo;>2r9f|^uЮH+_}՗1TxUHq\Gzf0qH>+_wJZg4[X#rkVԂwu)dٟp|{1j/ ltbdΉj=ZጭB{MN]W,Z 'ԍ4E|Aw'=^_^ .ƽF(rwd5RfiDDؚ` w+
+պnk1*3Th 2)frp>_P+co׶VKZ v2LN%YVdPpfzEZmvMrDkЭ墦+iV5ZO Nʘz-Њ5%Z kBjzn[F^o:ttCk" ޙ`'/PB\ټU[h<~FӅl~ZL*Np[S"$f 4b>L&Srvj%pPz;z٬]{e(l?pV!,UPMVomzo
+ap<Bztخms>aB`KgwzlqqdЮE5\ ~C`EoWXکO[`X3Na2栵QV%%Z
+,Y^*UÙi:]]2Q]/ӉXh %I,kplqVNh !X4^ &a,ɨm7j"!8*"~`asb\Gt2;zU/)<k}"ZDT%\oV+
+V\6>!iXBĶ:n'0lDkVA+xEDT5&`[Mae"ZÃUd5R*WkZEG~XЀId*ar岯AzDkH+HM$T*Me,"t+ރcODkkEAMS $+ŢRa
+p7d
+tfe
+Cqךq\eˀX!/ycq%Z
+G+E3HV4E0iMi
+UQdnX+kx`N EYGҷ_xZS{\ժeM%Z3J|_YNTJj5UeQTjh TURzvbE8q_sIq, Q]UxF rH jY\ w7D|' ﮠS= R13-2P1Fh,N3n^ [-!XcFD2LRk~+%P`8(6ЩT*L| JMv/{a3^^.dSWVԩ|X*˕Z~&] ,g۬sןd~!"ЩJh4v?b˭t]S,7Z)ND^]1P‘X^%ix2_{E;v5z9Ah" 1MdX ˶-CSn26k<&1CPt6gYnI t:9QE5B'lS9\7~<1ک_$bgjv{Q a=_ΞcDcZ1 _zdqT-=_|_7+_oӟΜdXm6iܳWV3b8Fb=|٣&ZѺzz]/K[ Y_S9T|E`z߮yدĮx /:фоAX9GYXL]J~{ qV~|||m3V80waCag TwΗnqK<;!F]qӬx2xSBPPw] ﯠZFcd:[(_i&hW+os]P1GcD*Jfwpa_`0tԩv%vAG8勥Jg^9AܰtYJ슃5/+zZrS x]@]"]*VjVŘ[oEU7y.`Ռ6]qp\m{ј̹Fhئ4*4+z5+՚L Y7dةD5)T]U6*np̣rJ|]]^dXk[Z;7* 9=hUD슅\!!3_;@* Gz)G^vA˕]m]2, `~h o.zzf+Vױy/!vF_S٣N z}!a=a铉~:vaW
+n{~\osrH 㤗Kfp؆\?>׳K<;z%1돟ȰB \蜯'͜PMKA1Npl&
+9׫gGwQOOjk? ׻2R*Wr3ffyI`]ZφJP$qӃk*_nj_xJYR8*9TTŃy.1-GL^D^~s|%Ⱥ鸮cjfNW!ox*[6{tUݴmSWd*zR/?~&92Jaȳt/\? WX2+!|:U^.ވ;IQUy~b++fz5vԄ]m"ؕ7 vE|DYQ= | \]J3OXHaQVUEڭY+ W0<2:۽>0
+b=ʕ=C/aH (oDPmdzVTuòmda9*a bڵTRV:ܓZ9$a p< Nj.ںstkÄ+Vzp֡fj8]/K9;WpB 7z4K^7Zj:lzS//h$sfYleW@_oS
+qܳgҤ WR^\%t\읬C1\͓zR{գi;mUa\+B\#z'iAV3?rH@Ѣs9$HsmY51 Pvf5՚{6ҒUf9yUOr^Nr:Kyz3k<[|>DԊ*fNx:n=7Z!MW%9HBt U:Ui*FROt\a{JrnTFR_n"3Tmp|z~~z;Gk'/>r ˏorotU*qpo</^^^_U&誖Ϭh"ct+tUNֈRO÷y;rnY2k"/7|ݺn]`/aYӹbֺ>xMΫDWu80,R|}8?ۯCWE|<px2+Vw06ۣ~ihb:y>"t}|~~~ZٰSͧAGDW9X2+DF d:_k59G2kVo4[no02zw8Za2z1cMtUx*[l۝֗av۬f~Ka&u؟WHkT7۝Nj>jZ (5lRƭk,pG9}dLgb1zj!۟W*>X*'⻪ 3OD|65tYɧb!>]O*Xc ;Btr.BDXkixbf3Ӝ)r\Ȯz)DWE]DT SrZVZr^k4+7ylok{
+ZiFr;ÇnO]UsWZ}cdYvotUCk=0t: +y>*ՒUUkx-&y'"jZRy1m6z0֪2quٵ?6kyo֫b3s2{z9>]5_mFӹ|.dbx4vR$!MWU|v45}<5gё>z=MӺVV.dr6)*ޯzČ:fhj\̉V*ޯl*FR.B!fRX8Ǖ/Id
+zIWJQ3-Rd"U5.םSb۷V)iY3
+H8 %쾣:DWW|`|\VŬ
+KV8]x2+/j.GáQ=nɪp
+d:uHH[D#bnIy&
+v.FvH4ć5hgub~&[@0o;*Nta}~~/Wҗp ~II*v{Dۓ_ +fqG֯M
+
+HN@ i@RrM;'yY{4e1c<O>flc]DZT+A6L65)'|5&`HԂi—#j
+ _=!dMJ<i橫vJ4s\4v>g
+ esӸT>U4g8 mf_,'p3Lk̚uԆͬN)>nu< AOK XKvO=ѣKvyCO+(4QU=EyzBO^+= e)īVS쉖\3<kTO,=S'M=MĻ&{JdOW穧({bÞ6G)STZX7OT\O0(*c (jZZ45QIph']ǀ.gݥ-zPh8G3(`vgCkHڻd|ex8!<c1c1c̛!
+HWcCz
+()RT `&ƶ4ƨIxo'IZ>3{^׽u{ש tU'IM)4_QKUX
+JUE1@t:J!#T-7OR0eP &fsq\f1TJm@4߮J&BH$HRL&J%"âSɤ'pp6 q
+aP7
+0(,q~Pک 6O$Sj.bZm6ۭ]fV)r4r[狤*L 7U͗(6@ yLE ިp;
+h2pqiUDGbx"L'Hm3(B!3ܫ'VL鰚 *M'_&Wljv2!ƇSD.ShnRK,j{k˕ 5\
+#Rn8-8UPݯ4TRtPrTvrzX ZZ\(&RfP8trべvRTc{h8su< k&կAET+Qp239;hcsk{gwwwg{ɣɱS#1\|~"hlBoF#؀iHx8Qd hy_h2'L6vONN?\_ˍ{m
+J8RiXN9GG'fWo?uӗo߾|zwhR1F c19|1$ V%Xt
+n?HmvшעraCpnb6"Q\5t@Ǝk;N4Ha3Sh/_>szXL2( =6-Brf 8AˤW|v=fJ(M <rNLBڀ A/
+դS(qe*a4T2I'9A&,n8(6_6WӉթysЦQr.^oRSJtFe l8箁19huB!K`8uvb4A6tX=>/b) %eC'Qm=tnz~u۷7Wʅhlb.+mhu'Da8:* U3H027:ʉpMf\."Sogu1 .YO۝rL5ٺ}}Tyu듃T& F 6l*@79K$!5Df0OxwKN8:ٽLT*M3Ɉ: +VvX{Dj|"7ͤhMTjZ=%J s_$.<|{ųt<qTLs`Dcdn<]:]o3AWO"39==9Dx~S~LmZ]]]^(<D4WYX-2Ã!äҮZƟ {D1-@b|f{Of2^SjY!aoN$" `RIx``k8vԅlSt6*wbK)lЙ入奅 9.TxIw{AUxxnV?2/>^+G>'4BZVA&XA=
+%sb>Vdw #oﺠƑXc&s77dЮkOa`"j6QX:_TJ$ 3o^s2:ʦW
+Ɔ=O*vـy*f b9Fw7uʠu< 1$ㄠ)(@v>S Kmu$qXL% 4](WjR65̼p9<^p!:X`b#)7ڏ%2(DN\6C;al'
+Hٵ}ѥ-̓yR/%u/ή?9Ufxk%GI\Wc<3G 52;Z _u7Kg҉ۢe 'F]*) E3Im &
+״]Id<t]Tcxx[k߷jLҟl-N}b#D'Hfōx&6O xvR!JD @ierR): 1 ;5(Ntȩ&S]~h7+Ϭbdg&WP2% #9ɍD88U˅u<؍ ý]t< BgL8gBcpTJv?3!Blp2WfX TyDztmHd!btm1Yh `Ͼ`,!9!lKhV+ĽF9UĮ.'3JMʵc6v$(xGgҡǦ.YNd7w,׸orQqZ2>q<{Z n0}lxzy\wJЉz]N̗SPF.M`ٛJׯj>6A-MsG.r
+>(B'K_̸Iu0Ƨ:. }0Fs+
+1^݄Gil̜]+R_/K0(lP.h؏eDd"FIJ%0NnŨ a#N}1L(;H:h~~ylSW6*`(x|=ÎWءS*EN<CsyhQGzR6!sHe0(ۀ<`p"ĄU/oZ3ݬ⍦!4[UL&z 4TNF(@IEp
+ٶ|s 4>u,Rh fIv&G&ycL՛^w)n+i8L
+^4},RdCR&fNy}>Mv+)0/d {<RU+vدč r0Љ}_xN%d ϟ*UWFb:Zw4_?>}xz1mk$ѹ[lmB] 9vE˟?ÚW dl_^^_v5g[r٬fL~@I.ڃv^.ȐqFroq
+uw|Z_аC-J"ݖ.;8c9ѽW;0fs^-aQ%8c7Rj?ӋAVr:1('_ivry9 2)Cq:qZRHdo3;pr\}]ZLGVtxX^- NZ& o Y@q{=Rb FѰj\ct! \nTP8dN"nK5t;$vhױt:l<j\op0NլW\Ƙr%rJ^UDNIjvr@j
+cHcBfH4c2{d4s TFp,F(#v">
+
+S‘bGR
+ yV|8zr](lG9;
+î.Tq 't:J=E\o:/4 0
+q
+/GS0 gs
+296 0 0 91 6647.5 7516.5 cm
+/Im0 Do
+Q
+ endstream endobj 844 0 obj <</CS 735 0 R/I false/K false/S/Transparency/Type/Group>> endobj 845 0 obj <</BitsPerComponent 8/ColorSpace/DeviceGray/DecodeParms<</BitsPerComponent 4/Colors 1/Columns 296>>/Filter/FlateDecode/Height 91/Intent/RelativeColorimetric/Length 6141/Name/X/Subtype/Image/Type/XObject/Width 296>>stream
+HWcCz
+()RT `&ƶ4ƨIxo'IZ>3{^׽u{ש tU'IM)4_QKUX
+JUE1@t:J!#T-7OR0eP &fsq\f1TJm@4߮J&BH$HRL&J%"âSɤ'pp6 q
+aP7
+0(,q~Pک 6O$Sj.bZm6ۭ]fV)r4r[狤*L 7U͗(6@ yLE ިp;
+h2pqiUDGbx"L'Hm3(B!3ܫ'VL鰚 *M'_&Wljv2!ƇSD.ShnRK,j{k˕ 5\
+#Rn8-8UPݯ4TRtPrTvrzX ZZ\(&RfP8trべvRTc{h8su< k&կAET+Qp239;hcsk{gwwwg{ɣɱS#1\|~"hlBoF#؀iHx8Qd hy_h2'L6vONN?\_ˍ{m
+J8RiXN9GG'fWo?uӗo߾|zwhR1F c19|1$ V%Xt
+n?HmvшעraCpnb6"Q\5t@Ǝk;N4Ha3Sh/_>szXL2( =6-Brf 8AˤW|v=fJ(M <rNLBڀ A/
+դS(qe*a4T2I'9A&,n8(6_6WӉթysЦQr.^oRSJtFe l8箁19huB!K`8uvb4A6tX=>/b) %eC'Qm=tnz~u۷7Wʅhlb.+mhu'Da8:* U3H027:ʉpMf\."Sogu1 .YO۝rL5ٺ}}Tyu듃T& F 6l*@79K$!5Df0OxwKN8:ٽLT*M3Ɉ: +VvX{Dj|"7ͤhMTjZ=%J s_$.<|{ųt<qTLs`Dcdn<]:]o3AWO"39==9Dx~S~LmZ]]]^(<D4WYX-2Ã!äҮZƟ {D1-@b|f{Of2^SjY!aoN$" `RIx``k8vԅlSt6*wbK)lЙ入奅 9.TxIw{AUxxnV?2/>^+G>'4BZVA&XA=
+%sb>Vdw #oﺠƑXc&s77dЮkOa`"j6QX:_TJ$ 3o^s2:ʦW
+Ɔ=O*vـy*f b9Fw7uʠu< 1$ㄠ)(@v>S Kmu$qXL% 4](WjR65̼p9<^p!:X`b#)7ڏ%2(DN\6C;al'
+Hٵ}ѥ-̓yR/%u/ή?9Ufxk%GI\Wc<3G 52;Z _u7Kg҉ۢe 'F]*) E3Im &
+״]Id<t]Tcxx[k߷jLҟl-N}b#D'Hfōx&6O xvR!JD @ierR): 1 ;5(Ntȩ&S]~h7+Ϭbdg&WP2% #9ɍD88U˅u<؍ ý]t< BgL8gBcpTJv?3!Blp2WfX TyDztmHd!btm1Yh `Ͼ`,!9!lKhV+ĽF9UĮ.'3JMʵc6v$(xGgҡǦ.YNd7w,׸orQqZ2>q<{Z n0}lxzy\wJЉz]N̗SPF.M`ٛJׯj>6A-MsG.r
+>(B'K_̸Iu0Ƨ:. }0Fs+
+1^݄Gil̜]+R_/K0(lP.h؏eDd"FIJ%0NnŨ a#N}1L(;H:h~~ylSW6*`(x|=ÎWءS*EN<CsyhQGzR6!sHe0(ۀ<`p"ĄU/oZ3ݬ⍦!4[UL&z 4TNF(@IEp
+ٶ|s 4>u,Rh fIv&G&ycL՛^w)n+i8L
+^4},RdCR&fNy}>Mv+)0/d {<RU+vدč r0Љ}_xN%d ϟ*UWFb:Zw4_?>}xz1mk$ѹ[lmB] 9vE˟?ÚW dl_^^_v5g[r٬fL~@I.ڃv^.ȐqFroq
+uw|Z_аC-J"ݖ.;8c9ѽW;0fs^-aQ%8c7Rj?ӋAVr:1('_ivry9 2)Cq:qZRHdo3;pr\}]ZLGVtxX^- NZ& o Y@q{=Rb FѰj\ct! \nTP8dN"nK5t;$vhױt:l<j\op0NլW\Ƙr%rJ^UDNIjvr@j
+cHcBfH4c2{d4s TFp,F(#v">
+
+S‘bGR
+ yV|8zr](lG9;
+î.Tq 't:J=E\o:/4 0
+H @MM}ZÄ
+f;q!!#ebH8R#eH9R#H9R#H9R#H9R#5Ƒp4Xr0Xruϯ\ yOM,#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#H9R#!H9R,#!!bb7so
+H{Lg=PxB)VZ"
+"iTj a+a5`R7 x"8  Cˈ8E$H!)'%/徯y>{lDZAheA&?c Z+0337701i{B1P{}X[<I ܘC'`kڊawc@V-ށH80?G=N#|Id ͕`0L ݕB!6 |Ґ,! v$
+t`s<=LOOÝIRHv%@B$S,׏/|f|?_Š@%FkhL7 Cvm" <o6DD,KBapPiX,2*:ƄEICŁ|.E#Y6b E G(MّÊ?älChFHab,N<z,%-=#ӄHOK9vTI\6B!Y0ֈ,oH%WҳO9V3YgNd(͢<la5b!ؒl^D&OJ+T|g4VVzRA^Nj\& d[8azq\uQion^^Z;U7VYZMUƅ^L06FbYۻ<VW\Up~i-߿oֵbu`
+%чRN_o
+ A0 gǞ_!Mq3m隦k)2t4"fzЋ1E"8$*Ԃ"^Eu7^ftQ"&y~SiV 9O<೗o=o WΟ0 7w5G/8<lln3ᔌsJs3Rtp={|3q@hHzNrD.;Ksҏ#C64~Q_QC"I"%;)DEw^/H-%:KNoxmO'- E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QFdD~/"H"2[ԵHO[ko%.to&x21q >^8;d%k)kqu,,i]2O//̌wZꊅ^~"~`]T|oڇ<ˑ;͵Eif>X'GSK;{O-[}ޯ[z>yRTZ,ETBzfg3oWV=ff㎛MՅ'BD%CqIU7>}jfn~af^|tFcUxRىx4X1ۙݽCc/&gf_{jvfzjPow3cXF-3&<&ђWlua/'&=51ѡn5;,1D|AaQ 9kC#OƤ;q`׵jGNFjBTXWV"^޾Hj/w^qo_׉K}us],Ϸ[HmD!8%3kvtvuǤk]wo]x07bӇ(d&"Z5:>j+t64_qS.ם7o\mnpV٬)*q*ec0MW;.5zRSc0Ϟ~dRV_[:XmLreU5uRNL\(s-Ih]_V{#CO:jʹ)(txQXp&/Ǟi=#"mĽ!h#b5#f?y*ve:ieeX-)&cLV1"rF
+KF 6ϝb6nKYF^bNA 0`6y~Yƾ
+q
+/GS0 gs
+274 0 0 303 6622.1162109 7246.1401367 cm
+/Im0 Do
+Q
+ endstream endobj 850 0 obj <</CS 735 0 R/I false/K false/S/Transparency/Type/Group>> endobj 851 0 obj <</BitsPerComponent 8/ColorSpace/DeviceGray/DecodeParms<</BitsPerComponent 4/Colors 1/Columns 274>>/Filter/FlateDecode/Height 303/Intent/RelativeColorimetric/Length 4305/Name/X/Subtype/Image/Type/XObject/Width 274>>stream
+H{Lg=PxB)VZ"
+"iTj a+a5`R7 x"8  Cˈ8E$H!)'%/徯y>{lDZAheA&?c Z+0337701i{B1P{}X[<I ܘC'`kڊawc@V-ށH80?G=N#|Id ͕`0L ݕB!6 |Ґ,! v$
+t`s<=LOOÝIRHv%@B$S,׏/|f|?_Š@%FkhL7 Cvm" <o6DD,KBapPiX,2*:ƄEICŁ|.E#Y6b E G(MّÊ?älChFHab,N<z,%-=#ӄHOK9vTI\6B!Y0ֈ,oH%WҳO9V3YgNd(͢<la5b!ؒl^D&OJ+T|g4VVzRA^Nj\& d[8azq\uQion^^Z;U7VYZMUƅ^L06FbYۻ<VW\Up~i-߿oֵbu`
+%чRN_o
+ A0 gǞ_!Mq3m隦k)2t4"fzЋ1E"8$*Ԃ"^Eu7^ftQ"&y~SiV 9O<೗o=o WΟ0 7w5G/8<lln3ᔌsJs3Rtp={|3q@hHzNrD.;Ksҏ#C64~Q_QC"I"%;)DEw^/H-%:KNoxmO'- E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QF"E0`(QFdD~/"H"2[ԵHO[ko%.to&x21q >^8;d%k)kqu,,i]2O//̌wZꊅ^~"~`]T|oڇ<ˑ;͵Eif>X'GSK;{O-[}ޯ[z>yRTZ,ETBzfg3oWV=ff㎛MՅ'BD%CqIU7>}jfn~af^|tFcUxRىx4X1ۙݽCc/&gf_{jvfzjPow3cXF-3&<&ђWlua/'&=51ѡn5;,1D|AaQ 9kC#OƤ;q`׵jGNFjBTXWV"^޾Hj/w^qo_׉K}us],Ϸ[HmD!8%3kvtvuǤk]wo]x07bӇ(d&"Z5:>j+t64_qS.ם7o\mnpV٬)*q*ec0MW;.5zRSc0Ϟ~dRV_[:XmLreU5uRNL\(s-Ih]_V{#CO:jʹ)(txQXp&/Ǟi=#"mĽ!h#b5#f?y*ve:ieeX-)&cLV1"rF
+KF 6ϝb6nKYF^bNA 0`6y~Yƾ
+Hױ 0CAfDa$ M@ :ߔ())-JAҢ()-JҢ(-JҢ(-JҢO--JK"ƒ-=Ϲ88MCkܗ8ǯ
+HkY
+A.W(l1cR@
+`
+hco5j
+EOqiڇjV?)?ch_u6PL'x")y\Y~OcuL!?&х=5prbޓO_} )@߾n|Z_}W~rtq@t.g?ogNm~~k5o
+=Bϻ,CX#R/di+kwz:yGwzvJ
+lw-vdZ=E3vfw8m\)ث C26`A6( LJu
+X ІZՑ`@$uZC . pL U*ZM RMҨb2\P(k`ĔC{KS A%hS
+E쫢ncKv >Ф6 0
+q
+/GS0 gs
+268 0 0 44 6625.1162109 7475.1401367 cm
+/Im0 Do
+Q
+ endstream endobj 856 0 obj <</CS 735 0 R/I false/K false/S/Transparency/Type/Group>> endobj 857 0 obj <</BitsPerComponent 8/ColorSpace/DeviceGray/DecodeParms<</BitsPerComponent 4/Colors 1/Columns 268>>/Filter/FlateDecode/Height 44/Intent/RelativeColorimetric/Length 1219/Name/X/Subtype/Image/Type/XObject/Width 268>>stream
+HkY
+A.W(l1cR@
+`
+hco5j
+EOqiڇjV?)?ch_u6PL'x")y\Y~OcuL!?&х=5prbޓO_} )@߾n|Z_}W~rtq@t.g?ogNm~~k5o
+=Bϻ,CX#R/di+kwz:yGwzvJ
+lw-vdZ=E3vfw8m\)ث C26`A6( LJu
+X ІZՑ`@$uZC . pL U*ZM RMҨb2\P(k`ĔC{KS A%hS
+E쫢ncKv >Ф6 0
+H F
+H?'uV7$sL QKBT䆵%*rlk(3`|En}~~}5B)I7F}%Y^F}-iзF
+胯Z~:koO[.%SMG:~o.qWNA8 },3D9>p2!y ЗF}-i ^F}%YF })IWB}5[0G`_g ~oKRȔB6M%t*S:(!+
+Hy<{KeXNǾeɞٲg:gR2D#˄K!B"Iɒ%Fi;s}<u?x>d@}S Z\~vVFFfFV
+;KWVeʯ;Ò
+dK$AA m pq 
+ Pk!!A~>^^n.$.ˆ&$["?O)h 0`@daQ1 I,/++#-& @!`$ppmTT@b_PXDL\v+)kZ45  u5Ue
+r
+4
+Lu'STRQ'h[XYw8t?]]99pgkmeanjblEPWQRKD
+!<s..>1BJjZzFfVvvv
+~fef\HJ;}:2"D()$qC]Mu ᄉ,fRp I)hhY"/`RɈظԴ+WKJ+*Q(/+-Z| ?7'+#-59)!.6:*d()8쒖d_ ޏZI+ ,WR ;'7O߀`3s/].ZRV~f}C㭦۔n56߬V^Vr쌋ɉc#Ï}<\a$5%yY
+SǞ9v,$Dlhk(+YRF dSXθPT!Y;D<I
+sN!Q1\+,.khjik ~:ltl Jp=599||l KoOwg{[KS}] d$Łȱo7'{k3#]X,NTX0:@a-[JP'Q:H<q*:.bVuM-w:`hxdt ϼ?PWfg_΀  r܌į#N}+H ȦZńBBZNI] "E'7ģAp~1_XxwH ~[\|͛`f^LON`[o7U"9c"HANVZjx)1!4KFXefWT20w/OF&d_)Fc}b98DÇ?B ݀c4fTf_|$tuk%W2SbH>nv{0~nV+-8yĤ4t-|I@uv[Gw'C179, 0?C+m[Csd2?$Ϟ=jomRVjBld1P[m7 ۃbX K˫hZ;x"UuwL l=ʖRh M~x5?;3=9>
+"{mn*/s*4>=zJrp`rmXU\|B2
+چ{C#Ƨ u-]" 8 VVV,lxL(?Bܙ/]ؘhK Xg_kEP1?@<y&BF~QY}<8261=3 o OrƅB&A"d{rnZRlÎv{Ud$NQ恆B,,xIs_ܗ?hnsgJ)eI
+aR
+PMԡ\#ʈk%)#eKٳɚc> s络Tw9O<~@?8e C 
+l ٴ丘ۡ.gľ56c<|}5GtK
+Xw,t-)nqIJ 4L`B},8dzdldpWWLM޽y1'tKjpMK00urIJF^qEu=Jd's"$I $0'=9~D#X_D<x="$,xx I gw(jBZVA٫֎~H;
+!2# Ã}oj*J^d<pˇ*a>^T)oyxWIJG,<|&r^V74wP ?13@|Vz]UYAvZ5*,
+O_+n,Vqn:~m׭Y)H cp @yoTV۽99ƢݏbQAB^[YGps<avHwVE\W\Ā%$%e!nX_$?+yUGoXX`=(@X2:FyDx_65ܣa-3|" )U ¢/ 1UAx<wB\Noi+`/GN)?,)Ymz&V\CPYY E1b,@P@Ɔ0Źć<Zއt
+9.sJ`lP 28{~H-DY0b6,<E,IuPGa)11P0Ե Z;^S ;=G0{ޮ+=M5%<h\qRX0`3sjgY5>dncX]{'GOg;Tx,ۃ ʜԷ<˅İ`0=q%8_^vg ѡ<Z>Qeo+R -_f<4)WiU -]}C<~h,]]:g P[Z" K VR28jx/$QJVQe]SG =_&Gk^g$Qo]vw8~Do6-mšjVڨ
+FLBƶ#p_p4 sػ] U%iO!:ʲb8<X-ek+(ů[&&CY@̧ _3۹Yn+26R2J۴ (~QCoI(7~Ejk|]GxVUv.Kɩ5:}7(2S^of}6/LF\jgqhMbB`T~aR6Na4 hwzx}6o.M}|78JUNjՊWʀOZYZ̢ER3>6o(xs3ISͭ%ʃ.V4<v98*.5!)v]u$;%6'W;:۔rZy0X&sEu0Q0KRΦ'wC[j@y˃Spcj!\24 LO!,o1F`p# xLO¸n,Hq~<-^8Иk6(i۝ (574JfcluISj5sc[֭ƺp0ИZ).w{񸥰ƦD<*/-.*)sCm5 kifę`Q5>#&)Y
+)RпxeR_Q~u%iq4؍ʎ}&6^ԧ%1K1`/l$TǍt+p
+ooTCcvD;Yiʉ 3;h~@4~L! yk{L.?3hawG CmY1n`{.4cLfvAq9FyHmj?#?+)5Z2sؘh=;:- &mh}`F eI[ .@StC G`tҡ_L> 4f-lQK ̷G&eݸG3&񪮢,/#1wK%A3OIc>3w7ӫvK }\HA\ݩ̠J}{|3*;z~K3T[^zbQ]6V!H>JpAqyu];c oWԽBf>Q8#[iŊ6ЀuJuNи WK6xOf=_V?u%dŚe 狀bHt`eh+8\N`F?])чݶlX$5 |{ߊV|C2n|^AVRġMC$h!L\x O:|jy^y'/qg[Hr1Zc rj:&.3>mh~;8Lf񮯳qvXi)K
+\G nKAiv5V mg&+o
+Ǵiа~&^Ջ:ʲK G1tb9e,>ie-
+x A v|
+#++L[Pk`>a_W n93 6.go=k&Էߪ yo4Pf6Y!ȿWSdU=m eɊΦ"3sH`Sykw{O}[ \(;9gR%)!n6&[nAIEMK`j w7v0:O{lY.;p[Y5]S{p|jf|[ȋDX-[ %CU8P4ظa5]!GȟݿA EcSyw1w<a i}^QfւyԄ~ YF\).oNA0uyPꅅpFCnGϐ:hP47-oZ 씆 a`J)@8@0t~'Tcb4B2 Լ$N0yXy15 ~iOvK>~$aaTh,
+4>WύZF ە P(0$rP9`4,i"9R9(Jˌl\EѠZx8px9AI8M 3VPhfPO7)!n6Fr#+RCkgH5@£_Qr`q,3Ì*p&v^iUS#7ѠZuh$
+Y
+
+vHRR 4. ![dD88Z~<󕗛ػJϿW7HD:hkxRle(!Jg0'&x%g?o!Aqƥ`wS9d\Rno@̅w^vh[:aik(r6gq~NrJ.b8zM\h 1^~zlfpqpV. EMCkCiW˞h}G0zp ֗N:mJ
+0*;|^)y I G7Nzn]*#Bbd/ "J/w=ߺ"sf2EdȔS&D ET
+4g*J
+X eCDGwf6znkӽ z>|k|QcRѷt O)G-|?c#hɽsx\Q}:#cc.+ px4p8?l(M <.<>թ" ~:<|KjHC*-UEmMEǧ<U!jﯗ" ZrI?s
+:`=UHe}!#}qve&6.g?H/F<T=Uhz~ gkÕB\ xow {^R~NUokMqo7])'x$ [JzNI卝Q
+Ӣю&#BW$m+]? NAN觾vqcow3ՒYDOdmH*[>ۏ񎛝pFEq> iCXFhSWӊ`7&?%=* y-S;7cmgЎ;ZU}c\:N.;X(y7I6.h9șZA1xp I$qL8E_6p &8(C8Pm0)A`(@![SM9z
+@gcyNrbj&ER! b`|JTTCRThJe
+ >6Ry̜BjF[V*4ʂ'.{W)Uh
+ɶn>}U+1AhRZUu Jjڻ=] "hVSs Vq9*.MM.kTm&Twƌ2)BA!>nfZr47$Vb302%MsGXp $ر^{(+- 07,x] XFcWSEnRţuy& 27$F+D`pDz: @SPZzߩk_V¹APh28& ?d ,msPGaZԕV*J6Gl1V2SD,@[xZCo=|G_{mq&И½dwHa87 yվz{㬋59-2w .m㏨`go;DCV8S iFGq]mj,[ h̚@Gtz;M]QAP(T1LcFWLaǣ“*>Ai|hٛjQLl:v H i@gCYv|-l|+t͝<#S^mAHX4 vJz.{RP38
+iF@#};Bc15 ƅt?]WH| )+Wӊ[{Rq aR]cԵ/k 2- FfNAF[Q h|iicQ3q9[vHiХ1%$nlrFS@AX(:H@?S2 h4Ӏ \?SɫiEխat?]BߐNK,v{]gpt &CObg`dʋ-݃#A!h
+q7Ք[2?0<˵;xI-o;q0F#Oīuh&͚'RPi>IRH(!J!q"RB(,%24i"͉QyNu߰wQ~{uz]z磩0yH*j<ZP۠W~;h"}t![c mH,2s?wyJ~e#l^h(MzjNC^0<v>qM|oFϯhm'h}e9Q78o3Re;ЧIy m!Xe OjXgD ^1yum.gnD%w6_c\q픓+6xDn=x:82!A6@uşޅy9ZQf%ͦ#GDNԵr[P8ڢ7طy"!.m&r ˨t
+
+1۠Gn t|{ ҂ژ%Hy}'<|QT3
+` EsB|\miȋ31lcKLnFGN.͎W60XgF'Ɋp#Gry_*%CKF>4򇶁
+p|A` tս
+pU8F&n:pT! u}⨁;f>O)lmQXCA|&>M-oAno$+>76pyG \ntpdB6U
+oE>
+oFEVT#``$ȪX9FU+8lG'UK{,V;bRa'QLU5-pTtRw6UܦL*NmPFDž;/>W5uQExp7罏fg5vR *Emn=Kίh':ɥgˋTbWXgs#*1UTt4P503ʭ\ktwumW
+;T<Sn?OΫ
+ 8'?T`@C\^
+8A/x8XVec6hcF9e䶞[En7FeAkAC5PY`%`*  rʩ"x'&%g=JB}×K q
+F[ |r|Z, 6ȉOةgbQFnbvi4if2>v[)A)19H,Z6O=z~k%ܹwlNPG&aϒrf\5]D2i!.֩1]mb}5/MuPF9wS_0JvT/ee93Hd+%C
+cI)$5B"(k%$%dm""ٲk_R~<"Ms sݟbbUes9>1}+hb
+\ln3:#*,4`4Ʒ(1,@~11E>#m R4TW.`w4p̙Ǿ U'p0
+zq Fcl8Z=0)`k1h|` 9Jk[x8&p
+jo(vb cw;C$vT?6FZJh2h`uB
+F$ =q@m$#>\w?'+UIJOx}G݃SU9Tpg\w>dUQRw<A \6nA-΄%d"ߍek&#h`dbXR
+L@׀k) GYghK,:H8@8p nifw*B>:}{??5|Xg-wL ptֺr',f+劬EE~=QIM3}؟no,zo^-%K8X,"8q:4>q96:^
+ 6:׀_ew%9E}+G*-C>$(X%Q{PԭlcmAV?k#m⟚ԠAUw[؟
+MEяFХmCeQ c:>T *ث :_}?"ܴo{ Sԧ8^% *aaW
+u8H
+q_72ufPՁ@38\4] #*쾩S Wp,Yj 1iU7L@ >(;%*uxϙ?ဿj@'}4#ç8}]UrRc.T\eJv(?3bkP_DRrX;bҼq>'Qi,\
+Zʁ#9_g#* N- JuH)m5rI)l
++BF8aRcuԅ[O_%10"mwk*J /uf1 |>;A!1UԷh3#=,(Is:ECiq2wF<s)6-5vƽA-*u'@L
+{c}Co8ϊx|qK-嵠۲48V@X;
+=X vm <;rH#8}/zPP^9q`0z m եF0~@MC
+!6Tg&EN/ bpH)jgt?nl#A޼,H 8>0H8RؤcrU μx`~R_Qx4jy?:x_M{V3PDe\(NBDʴ\}{G`xARhMl-6.r {D)̉Tذs*O; 2yl|Bɪn3s G pyόV#ɇqVJ%_#f(v$N0:snr+!2C.!TT5$CҀB,)ǐ"t3ʐ1CVfLd.i{=ޜug=-[o.#׷t LZ(Rggiϟ$߸bk,IcK~
+?mA9  Pj\8ni]AJd=/αG@TZqN.]WZ m9:bj0wK
+_M0ǒiZ;{!,^*
+V<F0L`-Uy7:ف*r֬ZW6XDVKVꮃv.烣ϯoǃj8`zIk}p^N@t7oob}3j|jnI 9Ϋ+@iT=I ww4١(S
+&Eu]#n~72јwx
+XǃAmȿ-jm
+?
+J@cOൄg(p\}$<M'mLd%.[ ?<`׮Sol{/1W"- ƀS#3z!]u%Y lLyZQܡchaz>Gc[=gb``%En`܊ v5߳MAJTp7uRjLOUPQ7jrb_|0K
++g NV͆ÿQbjJk
++މaSU[mzaIX<\|#Sr7ukm=-LӆzʼlPW m؂a~r̝⪆fjߋQ6gyT('ֵ`߳Gv| }KV 0<l񰴆Bƒ@p
+>jsCU1*P?k+mRlAoӃoWGEL/" ;QE?RS0#)6"ȡ}Zf"?xqons/$VJvA.F>>B(iHVJMY~V ߳ǭLޮ(+ZX!IJ^UkiOTVx|[+Gx={,d܊
+s2* /S08cs<(. RXԜB}52 az7Y ѡ,PI)Hm)-E~xCPDRNyǞ&G]GZ}
+2O_ <of&hC}혰K^.z$֭``ƁW
+\RV.`X{ /\W2[Դt ̑OaicӬ /?R`k1`/Y]e̔hdq@WSUA.)#x,_ו,x5D )+[:{G&` X@" 1*IEQ^ƽЋ@WKm /YR k+!)Hxz_ w?53m2$`P@C v>*-IO rq\ Y A+8br'Dx~8xDM/4w a PY"tĄso1
+G2Sn߸w YId [L>>!~9 eUud {H& Ijٞ@joV'݌
+ u?eoiOXxs-%/+^W@BaC&f0n‚*o~'
+: Dޒ$tRKV߱>by9Cmk
+r3Sc"}N9XTSƶ{[]a1)9EU= Mw @R3s J*([ک}@2jlLf
+" (
+j`Q1
+.뵭lu~g$_o`0y}ɛDx2?\_]Y;GMqs-jȏMLgHeu}s[Aȕkӷ?Xx_ϯ
+?7wG53=y} &qa6qf O&I%D9,-,#jX4721#YSml$&A.ّWP":TwhۉށsãʱS7gTgBݹ۪S7ǔÊ{;[ApgT*jfX׃tS$16 Z1(c3@'5M ߼+aϲExU^>195}sJu[JukёaŅ}=][VW-)
+q
+/GS0 gs
+398 0 0 398 6557.1162109 7246.1401367 cm
+/Im0 Do
+Q
+ endstream endobj 862 0 obj <</CS 735 0 R/I false/K false/S/Transparency/Type/Group>> endobj 863 0 obj <</BitsPerComponent 8/ColorSpace/DeviceGray/DecodeParms<</BitsPerComponent 4/Colors 1/Columns 398>>/Filter/FlateDecode/Height 398/Intent/RelativeColorimetric/Length 20921/Name/X/Subtype/Image/Type/XObject/Width 398>>stream
+Hy<{KeXNǾeɞٲg:gR2D#˄K!B"Iɒ%Fi;s}<u?x>d@}S Z\~vVFFfFV
+;KWVeʯ;Ò
+dK$AA m pq 
+ Pk!!A~>^^n.$.ˆ&$["?O)h 0`@daQ1 I,/++#-& @!`$ppmTT@b_PXDL\v+)kZ45  u5Ue
+r
+4
+Lu'STRQ'h[XYw8t?]]99pgkmeanjblEPWQRKD
+!<s..>1BJjZzFfVvvv
+~fef\HJ;}:2"D()$qC]Mu ᄉ,fRp I)hhY"/`RɈظԴ+WKJ+*Q(/+-Z| ?7'+#-59)!.6:*d()8쒖d_ ޏZI+ ,WR ;'7O߀`3s/].ZRV~f}C㭦۔n56߬V^Vr쌋ɉc#Ï}<\a$5%yY
+SǞ9v,$Dlhk(+YRF dSXθPT!Y;D<I
+sN!Q1\+,.khjik ~:ltl Jp=599||l KoOwg{[KS}] d$Łȱo7'{k3#]X,NTX0:@a-[JP'Q:H<q*:.bVuM-w:`hxdt ϼ?PWfg_΀  r܌į#N}+H ȦZńBBZNI] "E'7ģAp~1_XxwH ~[\|͛`f^LON`[o7U"9c"HANVZjx)1!4KFXefWT20w/OF&d_)Fc}b98DÇ?B ݀c4fTf_|$tuk%W2SbH>nv{0~nV+-8yĤ4t-|I@uv[Gw'C179, 0?C+m[Csd2?$Ϟ=jomRVjBld1P[m7 ۃbX K˫hZ;x"UuwL l=ʖRh M~x5?;3=9>
+"{mn*/s*4>=zJrp`rmXU\|B2
+چ{C#Ƨ u-]" 8 VVV,lxL(?Bܙ/]ؘhK Xg_kEP1?@<y&BF~QY}<8261=3 o OrƅB&A"d{rnZRlÎv{Ud$NQ恆B,,xIs_ܗ?hnsgJ)eI
+aR
+PMԡ\#ʈk%)#eKٳɚc> s络Tw9O<~@?8e C 
+l ٴ丘ۡ.gľ56c<|}5GtK
+Xw,t-)nqIJ 4L`B},8dzdldpWWLM޽y1'tKjpMK00urIJF^qEu=Jd's"$I $0'=9~D#X_D<x="$,xx I gw(jBZVA٫֎~H;
+!2# Ã}oj*J^d<pˇ*a>^T)oyxWIJG,<|&r^V74wP ?13@|Vz]UYAvZ5*,
+O_+n,Vqn:~m׭Y)H cp @yoTV۽99ƢݏbQAB^[YGps<avHwVE\W\Ā%$%e!nX_$?+yUGoXX`=(@X2:FyDx_65ܣa-3|" )U ¢/ 1UAx<wB\Noi+`/GN)?,)Ymz&V\CPYY E1b,@P@Ɔ0Źć<Zއt
+9.sJ`lP 28{~H-DY0b6,<E,IuPGa)11P0Ե Z;^S ;=G0{ޮ+=M5%<h\qRX0`3sjgY5>dncX]{'GOg;Tx,ۃ ʜԷ<˅İ`0=q%8_^vg ѡ<Z>Qeo+R -_f<4)WiU -]}C<~h,]]:g P[Z" K VR28jx/$QJVQe]SG =_&Gk^g$Qo]vw8~Do6-mšjVڨ
+FLBƶ#p_p4 sػ] U%iO!:ʲb8<X-ek+(ů[&&CY@̧ _3۹Yn+26R2J۴ (~QCoI(7~Ejk|]GxVUv.Kɩ5:}7(2S^of}6/LF\jgqhMbB`T~aR6Na4 hwzx}6o.M}|78JUNjՊWʀOZYZ̢ER3>6o(xs3ISͭ%ʃ.V4<v98*.5!)v]u$;%6'W;:۔rZy0X&sEu0Q0KRΦ'wC[j@y˃Spcj!\24 LO!,o1F`p# xLO¸n,Hq~<-^8Иk6(i۝ (574JfcluISj5sc[֭ƺp0ИZ).w{񸥰ƦD<*/-.*)sCm5 kifę`Q5>#&)Y
+)RпxeR_Q~u%iq4؍ʎ}&6^ԧ%1K1`/l$TǍt+p
+ooTCcvD;Yiʉ 3;h~@4~L! yk{L.?3hawG CmY1n`{.4cLfvAq9FyHmj?#?+)5Z2sؘh=;:- &mh}`F eI[ .@StC G`tҡ_L> 4f-lQK ̷G&eݸG3&񪮢,/#1wK%A3OIc>3w7ӫvK }\HA\ݩ̠J}{|3*;z~K3T[^zbQ]6V!H>JpAqyu];c oWԽBf>Q8#[iŊ6ЀuJuNи WK6xOf=_V?u%dŚe 狀bHt`eh+8\N`F?])чݶlX$5 |{ߊV|C2n|^AVRġMC$h!L\x O:|jy^y'/qg[Hr1Zc rj:&.3>mh~;8Lf񮯳qvXi)K
+\G nKAiv5V mg&+o
+Ǵiа~&^Ջ:ʲK G1tb9e,>ie-
+x A v|
+#++L[Pk`>a_W n93 6.go=k&Էߪ yo4Pf6Y!ȿWSdU=m eɊΦ"3sH`Sykw{O}[ \(;9gR%)!n6&[nAIEMK`j w7v0:O{lY.;p[Y5]S{p|jf|[ȋDX-[ %CU8P4ظa5]!GȟݿA EcSyw1w<a i}^QfւyԄ~ YF\).oNA0uyPꅅpFCnGϐ:hP47-oZ 씆 a`J)@8@0t~'Tcb4B2 Լ$N0yXy15 ~iOvK>~$aaTh,
+4>WύZF ە P(0$rP9`4,i"9R9(Jˌl\EѠZx8px9AI8M 3VPhfPO7)!n6Fr#+RCkgH5@£_Qr`q,3Ì*p&v^iUS#7ѠZuh$
+Y
+
+vHRR 4. ![dD88Z~<󕗛ػJϿW7HD:hkxRle(!Jg0'&x%g?o!Aqƥ`wS9d\Rno@̅w^vh[:aik(r6gq~NrJ.b8zM\h 1^~zlfpqpV. EMCkCiW˞h}G0zp ֗N:mJ
+0*;|^)y I G7Nzn]*#Bbd/ "J/w=ߺ"sf2EdȔS&D ET
+4g*J
+X eCDGwf6znkӽ z>|k|QcRѷt O)G-|?c#hɽsx\Q}:#cc.+ px4p8?l(M <.<>թ" ~:<|KjHC*-UEmMEǧ<U!jﯗ" ZrI?s
+:`=UHe}!#}qve&6.g?H/F<T=Uhz~ gkÕB\ xow {^R~NUokMqo7])'x$ [JzNI卝Q
+Ӣю&#BW$m+]? NAN觾vqcow3ՒYDOdmH*[>ۏ񎛝pFEq> iCXFhSWӊ`7&?%=* y-S;7cmgЎ;ZU}c\:N.;X(y7I6.h9șZA1xp I$qL8E_6p &8(C8Pm0)A`(@![SM9z
+@gcyNrbj&ER! b`|JTTCRThJe
+ >6Ry̜BjF[V*4ʂ'.{W)Uh
+ɶn>}U+1AhRZUu Jjڻ=] "hVSs Vq9*.MM.kTm&Twƌ2)BA!>nfZr47$Vb302%MsGXp $ر^{(+- 07,x] XFcWSEnRţuy& 27$F+D`pDz: @SPZzߩk_V¹APh28& ?d ,msPGaZԕV*J6Gl1V2SD,@[xZCo=|G_{mq&И½dwHa87 yվz{㬋59-2w .m㏨`go;DCV8S iFGq]mj,[ h̚@Gtz;M]QAP(T1LcFWLaǣ“*>Ai|hٛjQLl:v H i@gCYv|-l|+t͝<#S^mAHX4 vJz.{RP38
+iF@#};Bc15 ƅt?]WH| )+Wӊ[{Rq aR]cԵ/k 2- FfNAF[Q h|iicQ3q9[vHiХ1%$nlrFS@AX(:H@?S2 h4Ӏ \?SɫiEխat?]BߐNK,v{]gpt &CObg`dʋ-݃#A!h
+q7Ք[2?0<˵;xI-o;q0F#Oīuh&͚'RPi>IRH(!J!q"RB(,%24i"͉QyNu߰wQ~{uz]z磩0yH*j<ZP۠W~;h"}t![c mH,2s?wyJ~e#l^h(MzjNC^0<v>qM|oFϯhm'h}e9Q78o3Re;ЧIy m!Xe OjXgD ^1yum.gnD%w6_c\q픓+6xDn=x:82!A6@uşޅy9ZQf%ͦ#GDNԵr[P8ڢ7طy"!.m&r ˨t
+
+1۠Gn t|{ ҂ژ%Hy}'<|QT3
+` EsB|\miȋ31lcKLnFGN.͎W60XgF'Ɋp#Gry_*%CKF>4򇶁
+p|A` tս
+pU8F&n:pT! u}⨁;f>O)lmQXCA|&>M-oAno$+>76pyG \ntpdB6U
+oE>
+oFEVT#``$ȪX9FU+8lG'UK{,V;bRa'QLU5-pTtRw6UܦL*NmPFDž;/>W5uQExp7罏fg5vR *Emn=Kίh':ɥgˋTbWXgs#*1UTt4P503ʭ\ktwumW
+;T<Sn?OΫ
+ 8'?T`@C\^
+8A/x8XVec6hcF9e䶞[En7FeAkAC5PY`%`*  rʩ"x'&%g=JB}×K q
+F[ |r|Z, 6ȉOةgbQFnbvi4if2>v[)A)19H,Z6O=z~k%ܹwlNPG&aϒrf\5]D2i!.֩1]mb}5/MuPF9wS_0JvT/ee93Hd+%C
+cI)$5B"(k%$%dm""ٲk_R~<"Ms sݟbbUes9>1}+hb
+\ln3:#*,4`4Ʒ(1,@~11E>#m R4TW.`w4p̙Ǿ U'p0
+zq Fcl8Z=0)`k1h|` 9Jk[x8&p
+jo(vb cw;C$vT?6FZJh2h`uB
+F$ =q@m$#>\w?'+UIJOx}G݃SU9Tpg\w>dUQRw<A \6nA-΄%d"ߍek&#h`dbXR
+L@׀k) GYghK,:H8@8p nifw*B>:}{??5|Xg-wL ptֺr',f+劬EE~=QIM3}؟no,zo^-%K8X,"8q:4>q96:^
+ 6:׀_ew%9E}+G*-C>$(X%Q{PԭlcmAV?k#m⟚ԠAUw[؟
+MEяFХmCeQ c:>T *ث :_}?"ܴo{ Sԧ8^% *aaW
+u8H
+q_72ufPՁ@38\4] #*쾩S Wp,Yj 1iU7L@ >(;%*uxϙ?ဿj@'}4#ç8}]UrRc.T\eJv(?3bkP_DRrX;bҼq>'Qi,\
+Zʁ#9_g#* N- JuH)m5rI)l
++BF8aRcuԅ[O_%10"mwk*J /uf1 |>;A!1UԷh3#=,(Is:ECiq2wF<s)6-5vƽA-*u'@L
+{c}Co8ϊx|qK-嵠۲48V@X;
+=X vm <;rH#8}/zPP^9q`0z m եF0~@MC
+!6Tg&EN/ bpH)jgt?nl#A޼,H 8>0H8RؤcrU μx`~R_Qx4jy?:x_M{V3PDe\(NBDʴ\}{G`xARhMl-6.r {D)̉Tذs*O; 2yl|Bɪn3s G pyόV#ɇqVJ%_#f(v$N0:snr+!2C.!TT5$CҀB,)ǐ"t3ʐ1CVfLd.i{=ޜug=-[o.#׷t LZ(Rggiϟ$߸bk,IcK~
+?mA9  Pj\8ni]AJd=/αG@TZqN.]WZ m9:bj0wK
+_M0ǒiZ;{!,^*
+V<F0L`-Uy7:ف*r֬ZW6XDVKVꮃv.烣ϯoǃj8`zIk}p^N@t7oob}3j|jnI 9Ϋ+@iT=I ww4١(S
+&Eu]#n~72јwx
+XǃAmȿ-jm
+?
+J@cOൄg(p\}$<M'mLd%.[ ?<`׮Sol{/1W"- ƀS#3z!]u%Y lLyZQܡchaz>Gc[=gb``%En`܊ v5߳MAJTp7uRjLOUPQ7jrb_|0K
++g NV͆ÿQbjJk
++މaSU[mzaIX<\|#Sr7ukm=-LӆzʼlPW m؂a~r̝⪆fjߋQ6gyT('ֵ`߳Gv| }KV 0<l񰴆Bƒ@p
+>jsCU1*P?k+mRlAoӃoWGEL/" ;QE?RS0#)6"ȡ}Zf"?xqons/$VJvA.F>>B(iHVJMY~V ߳ǭLޮ(+ZX!IJ^UkiOTVx|[+Gx={,d܊
+s2* /S08cs<(. RXԜB}52 az7Y ѡ,PI)Hm)-E~xCPDRNyǞ&G]GZ}
+2O_ <of&hC}혰K^.z$֭``ƁW
+\RV.`X{ /\W2[Դt ̑OaicӬ /?R`k1`/Y]e̔hdq@WSUA.)#x,_ו,x5D )+[:{G&` X@" 1*IEQ^ƽЋ@WKm /YR k+!)Hxz_ w?53m2$`P@C v>*-IO rq\ Y A+8br'Dx~8xDM/4w a PY"tĄso1
+G2Sn߸w YId [L>>!~9 eUud {H& Ijٞ@joV'݌
+ u?eoiOXxs-%/+^W@BaC&f0n‚*o~'
+: Dޒ$tRKV߱>by9Cmk
+r3Sc"}N9XTSƶ{[]a1)9EU= Mw @R3s J*([ک}@2jlLf
+" (
+j`Q1
+.뵭lu~g$_o`0y}ɛDx2?\_]Y;GMqs-jȏMLgHeu}s[Aȕkӷ?Xx_ϯ
+?7wG53=y} &qa6qf O&I%D9,-,#jX4721#YSml$&A.ّWP":TwhۉށsãʱS7gTgBݹ۪S7ǔÊ{;[ApgT*jfX׃tS$16 Z1(c3@'5M ߼+aϲExU^>195}sJu[JukёaŅ}=][VW-)
+H #7
+d}4 !#чCۧOD_ϟGxt/p+u%nD_:M[C$ч2}0#_.N3 }<c/.4
+E6(BPd"+٠
+UV(BlPd*+Y
+E6BPd*+YUV(BlPd"TY
+E6BlPd"TY
+U6(B Pd*+YEVAlPd*YEVAlPd*+٠
+U6(B Pe"TYEVA Pe"TYE6B lPe*٠
+U6(AlPe"TYU6(AlPe"TYU6(AlPe"TYU6A Pe*T٠U6B lPe"T٠
+U6A lPe"T٠UVA lPe*T٠U6A lPe*T٠U6A lPe*T٠U6A lPeGlPe*T٠U6A lPe*T٠U6AUU6A lPe* <,(@ lPe* <,(@ lPe* <e>_ lPe* <e>_ lPeG~\U٠D\T٠Dq>\T٠F.alPe* |GA>\T٠_D.1lPe/#U67|*TYe>@ \=ʻS˼*<Y;{6rwVe#ycU۪eӵUeUQ.G.,B2o/E.f,b2oe둫7*yD.ު\=[x3rPe#y*yu#"WyuC*ymc"Wyi"yi*y]"WyY#yYC+yMc#WyM+yE#WyA#yA7T.j\k)rr[2U^ƍ˼[+y Fn\ P̴ ̬IˌV̜yˌʐ̘̈<e\ɘU
+\晰e\Ye\)eNсEp8:G~`tڟ_+CYGq$:GD'q_9 3/Gc~~ tʯ5CCs:@'|~ϢyS]A-:5[]E#+϶C{ f\
+usK~otwm>хƠ_\gǕmF\f,EYF\ˡ܃~u-t.Nq+EF:8:,yASgCg&ПϧзOE >E?2.p?5E}gB׸z"я24G.3}D u[c~mCt6Egjkt'7.-S@_sSDG}oE-*lQ`{أ&k-
+Hy<swk)a,c[ckK]R%e)BTԡVɉD*ʖȖ%[,Jۭ{۹7تxt۹ן13;"""~wLMEp;M&}Mk.Gz#ut8|2",&_A |;Ff`/6^ZdYY988vnbggceE∛Ƭ y!L/Z/]66v]ĹDEvDZ̹h"mcv1]n/
+5!K5E㙕΋tET\Bre2T'Reee-^")!.&JAHq)Ԅ/,80'
+.•WT)khjjiiϙ2MIQA
+Rb"B|<܋9'Y$=ůY1`د0EL\Rj U^q9073562]B[(Olq&3IwbOb$ )()͚vN]\]]f .8oprt_gfJKsScC}]mMu<u5:pi8IDd!1 eJ4U &f \7{nz5oV/M]{N- 8YzrJB1Ii9E
+
+aѲA~vr\3fZPD\ZVQy70$<Sgf^UR^USSF.ȾÇBd{$0X?{P[]y0*l:Ña^
+ʚz&Vk\=}ęW߫mlFa/../ Y#W/FA6pNQA^vFZm.-/灃ZSfK1u:B£q’
+qk{W/(
+_BšFXaAvzr|LxϒLhB׮EΙcAq)m* w
+OF)FZ;CfwO܌i ֦U
+#C\[LPٶIFJ\DP
+wil/ݼUPu1#oIcҟnoixV]Qs#츾pFq?j50»XȸGP]}Q3!fH1Ն]{;⺯ @[m'\Ӧr YO5_?͆i['Ok[;{̈'0#i0Ɔ= u%yB=lM DAx3gi"k`ÇE0s UXVY 1Sç5]4huqC<lOg5"KA<S8cH<|.GZ 3vƌӲ@ 0SO*QA& nyQ JF (+%|ɂ3ygpi;s%ťdaWcƗqbZNqyu}S[5xQO&'aƺ4
+gsc}mUM2Bmeb!QIMʪq,f\SO$c47zd8YOkvuW.[4m63uY#Y[lu
+jۢ>MS\QSߌSb<iG7744ww{S} ✈9ېTQ -LhL 25%H6xs7"UOjč97T<{8Z2صYVJLig:[0΃d-,&%y)kGP\?c|@#qqt5M둶g+13y?MjZMg<@0z ~čV4ΰR[߃ k03<TQ.XH{Xػ\JH.*G}EbL?8WeEz9ےtam ̛Ǟqf<XHֺF$[g";]Me<MT_ #
+U߉sw{c]ei^zbLV9)1lgF KmQ3w IL+k0FęP$'5>2Xa+hq31̓Yd:eCf6^A9%kں#ar_gˋLmwZ{׈A;&&l=k:L֢',ܑ3 k^tن1:緯G^v4W'Fؑ# cG63fχiوd_VUrh[aq=@w[#vkV'8C; qfukSm kB?n٭yfuc[mÜ?9 k;#)693%p'aq ٹ#y7NC8gvܴΞv*')l1X3<|hv^=3WoƧ>kYBg+YӏA O+2oQ⬮qy,nmg΅%%W)1IO٭g;aO huB_sf<Xڸ
+f>wK-I52vXaD] nbikJ'd ټ{ɳN^ףQ#C{Pٲeyi<ءV[%1*5Z^I!/vJ42dUmXa(I1֦GTڰg`9+_@H\Za>]3"?y'r + 975.AU%y rL x`kSkg'Ϛ: SVD#G65 O $F]v4>OyТM]W,uC97<vsH#3EAu%n\65ܥNBX6]SPPTjvuQ
++j{_9<4psfjقʙ6Z$$wuv ]dhq!v4H
+<oq쐪䊥 <9S*.auPG~uWVf79!4ɱW.X@9oX#
+56m\%e!jl^ Gy=aکB9SAZl`0'7fvcPAIOꚻ Ga>dnvM`GE@ z6u]c WBn!5ؚ_ĝ|OSݤ#GBCYBEc\ELddI]
+-x ),Ckɾc_ᖚ~s;LWg{~ޯ7ZW^9>줷
+Tm^Td2k-wG'n_k~?5?I/# ޼xcJU% dƂRrxW\Rƃe-}C Θkӛ^,{+!/e&Uj
+҂j>s?^Ϧ׵u ךjOh.}{fc`QE%!kZ;y x#!T~p_Ɔ;[k˞=H =vp:lQ "fdrw5@%k֬`=62VW^LJ}YTys 3;d-3[>A@n`V2~YA6,
+jϩڠ$')&"p?lnL=IiMKg?dd~? YhUܸ b-d_p̵@[Y`  Qwrw1T& O!oؤ|(w{ UWE~J lkf,0
+ dC
+nAUi_9YPL ǥdP+h=\<8@XTOg\ #`ePAsrv.(\95,膋*?3)6
+CY0iO~phMZr
+
+EA1Ow4UQ)jamU3ryA^kȩ/[
+L)CemvպmιmX{W?x<tV_CQ0z;}ZPdjA舢2 幉Of{R[MVa FQ/ai&w%w~ zB춚1\-T~elz ̝}gU^͠M4WF]xZoJ |1 xOD_Oce xX#La`FՋi ^nc3ն} P^Ő:{(ogs Eq~Q/Z6^Q9TR *[z?gzj`' o"SFLZQ̜BR5I98> k w@{mI&"`Fvnزk4:y?ի 5 poseAJdUS?o[5^QZ'l܋HzתqHJܭ~9c+'2,8s.7Cb^ gNަG~^y1^6e  e.aUvW4yCܗ69 )NfeLFYBiøA2Wσ}5fQQ1Z@X|OӇ<xMٜRb߰tI(s(.kEtM3)J/fMʲj:fW
+ZfFTE~ʳvڪ2\,KyY^
+|l ZʞCYFMc 3t!="%DGʞ~#K72  欸\hȋ2lXHQgQ(c+$Z+ Rfcrx׎[_k֬zZeqF9e @Y;K3cB|+u"TBҪڦv^
+p0n\̰{e`Sw (c)fOvԕ~#",q/:-[vkZXPNʞ8M;V(Io^ #*OجR2W@{mq`&#LOWFf#+T
+.l:&NhF9\ڎA
+h_kUAӀ+7f݋WL^M=f>i"a]fL2(9ڥibͨmc{a+0S#y1_q3,^>!Ȍ30/_<=9>؁){SmȿP_pae`똕݈ʖQ00*ωu9 _6^[TM!zUR@[!g.F݋GTn99(c,15U_
+ Sj2BU6Z؛<d|᷀gm{1fȿZ`la!/JIe)Gz^̬Gzښhࠤf081w&,;6ua.W69$wizFՠ
+{Ak2?鉿NA&63N>exȽ>ؿA^'g [Lgd$)o(llЛPeRP
+ [Z0ȿ*;&,T>q=Pa1g:eG
+VvSyŕ"g@ac4KlRas6(l\,{6 <İAac:l'e9YHa3oW4 J̫'w.[EyXUk@SHZUwHlVYc7(lLi`GmqzTv~v<hY38(16CƲoSB^0#gO\q+iE5ReT%>s;oOn7 =ͺ3iG حep҆n<(ll\5EiWTccX0#gKXV][a {G&᠕n(|຃- (#Kw䂪IPsbCnBحKge-L:;C;*:s@ Prʞh*Hw4BԂ>9T.vT(lz"a8#RƇvJ/x./߀&{-|㢙 ƯfYVYy}RX>023޼ u1?yY6
+~URׅ'y|0]+#‡>˴Ig;$6>`Ga?Ȗ"J^Ey٘|0~J
+(KM%˂tDMPX JzAP09{Mt=g3s]W%! \]H,ffzrż\<js׊XM.^[3jyXƇԲk@tJ~eXB(ў/:b'[ZƱʪygעZ%\j"MA-S2mݱ"n5tZ#\[eg&+Ê[_cd{{Gk< }!pgCYNRĹ'ޱ)(c0olf2ʋߔ?w#{/L-,z#(6m`2$yaf2/9
+,Rm[h*ogVѳr I+i@\R3zKN
+|쌴N)23Q tHA)R0
+RPJM [bߴVy3>q#萂)xwCu%Bl)MLu!~z7= H;JɊ0eU[9l{^nESۙH
+|MyQYOxRNR1_Dy# GDVlxbvYC0R._WބcU3K.Ŕ!e * ;,!)Õ`xe[[YÓH|2Nգ^!2K;2t!*`kLs PDʐf2=5eϐ: _EqAz*҂dxg eW#(YH*Sc=r;Q1=Pn)L tUƔ*3q
+JӳvK/m@ʐei3Ph.HpQ
+i*Р RH$dPdqoEua۶}z׿ps}m7Аo?*hZ;܈{KkhW[*?޿h.+H&6^y ;^M/n[Dl}yb7aj<K4 e^Us7yd ZFj}s]UiA.?ѵ#$;~&"ZSЖ:˲߽tbeR9Yh-(ga򾢱D ZO;J p۳yRI-s!k~΁oPˠfׯ>^[wd?3?Y8T_| -e<}h8;3-sK,]cxے+@ԏ/_u6R]4ef>qUƻ\QT7ZSF{ZcqڱAS^H-g`f_$eh{3/#?d'prwSUWO9ZX"H2$Ll"v8^P38^)R1
+"7%&źB[f^/󪚺QG@g}yNRT~s]UiA.yZfd]gpLJnEc -wԕf=s}fmIN.AiU]QIQT{mqfBQ;5, t-wf~
+|1O^ OSbB,kztu֯F" .pG]gN7UAKoQI9@pxeć3]Tr&/{"ߖԶ CFY.Hli E/qƻ\zK+f\:Ɗr2Аec&_4_qә򪚺`q,e?q`7Y+um^1)?5taCh\lZYf/Ζ}/F>*7 Agգ6,<aP^cȅO@ ruYh6H0)hmtf"fgb,S 惞90dc;,\Ge.LL7tD$-m3{BnOlYƶnƽ Agy{!ގV2mEWlSs+Hx?kiֳK'f#$\oߕudc;5͓ڙY*)2,<R*kMw Ka;)$bSeˇ84R}afW\ih}*$
+@63Ge'EyܦDxYF+RAI(A˘
+VJwcLZ0,S)VnrO,irhO(UJ*#GU0
+ʼs)i8a^U6/19 =ODʬ9u#- dD823/U~A/8X'{ T"|f
+ _;O_SSoY'ポ^ce.+|!c7Rs׶M1:gT_kջCKEjEl
+g 4uԁV& p/qR7Z?02!UY]'S,)~vR_UzEиpLX@aΨ̤3wLKQBpA\^dɹc
+Akzrt=Q[.]{0VշDՔխ}#D3ku=Ou1Ql^lL9y~;#*P+MKfQw/BƔ-:eIM[(q!\Y,9.; ]e0R^aLtғOMC_!,
+_'^8Ql @yvL.]vG@čԜ5fro碬WnZE3ˡO * ,
+_ukA63'7ALNhþo>)0@fe͖( r/2\|Rʺ+mw`gvX.(/pF`fc!k߾#)33QV Q9ETt-vhvcI33<e?2Vٜ<@KjF& L ^߿}i,ؘ0K0_N|[afj&"(JOD,(c
+|f}eW`gfF(7U>K;,( >J[Cgd}v6sq47- /jfm{]KysKW/ݍދ sݴJ_,|R:ֻ~eui(`&FڪKrRoFz:n0efd˹+
++{ f&]mg*-B (l̒JfJL-m!BcBpm*~x="`zcMy*QF- &f`/4OȚWT7ݾtv?5(/WHBqg/K5;Pn,zoGn]k!'NeL
+ضXSE 3']S|'͇Q"l׭%9z6AV7E ,$k
++fTH}=Q1/3)&Q/uZ(3k
+]ާrJ[ag3.}]Y<%><`vD$ig*`n~!1Iyag3,}>7-bAg[ =zeJ2rv62ƆoY\C^2.`2z>AH};AA<=9u̴i׋0C:{-wag3,S>.j2bN"RJf u4<3}>婉6}-Ļv}l9 _35ql0 5fR"l<2y(Pt)|D T<Z_M} leggV4v ag13?5^[&#)&ߍ4U/ҙ):`9%U-=CgGΆO_ }^0.٨g$e)mnQ͟e޼pެ_ʳ <q_@ص:F' _3=B~Ȉzîk~M^ 2jz6ާ.|)߿Fԓ{qz8l0RO_gfG=[^c{ÿFJs
+{̴'Ч F^;uUeDؙT2q\2j L`O>`DٽP]N\^}]lQU]sk'Y#S4n^|9}:cME a>.z5~f ,7E%fU6v @Ѧ]fuyW~;QҢh_xgs K(j9 ^sNIUs1|4 v)`^ Yϟ8fw1ݞ2~fDqllRҚ^h`̏ʢԄ W5]ż`Nꭴv<~5Iއ:kUЧ<WUIN`?7)"#}l0 V9{ml^=53bne"MEqs"sJQhC/&(hMG&WN zؕ9%"e~;b`i9şpцg:$o/JyҀ1ŐykVY/>_C$*4!a59hTBqNr!#FNIu{!zwxΓy_ИYUh
+# t՗e$Dy;W_CIfFL3ň9܋K.nBDc!P=m ;Wmoߨ"')71aL10mcӞא)Amzr4
+̜Q(# L\FQ]o'_/mB1
+\+h<$R?c_(C]-%y,kMe 6/
+fxŀhoeaM$2~
+99&ݑ`(#!~(I6+
+0kBqw}E DW]IVR@ y`c'!C/)kS] eYI~䇚 ì28
+Y@e\Շc~ɐ{;kK EyC@3|~h)L/#-dv<6f9oÌsio. [B.cb&rKk;{Q9 z(`_7A _htRfnIMSGQPYq՞`̘G`V
+q32d
+f.~aemuߑ_+@omi6[W.L~Q]Xl\ <},$tM{\}>My_ZZ{j6?d\?a[GCE^z237+T5t|~,ƶ)ôm]_QlJInٜ c&yb@́] NL)mǙ|H[זgq~íd
+U f/ dwukrOGK}%Xku?SN25q/&-~sl6wC cIۦ 2R֍e"]p1߭qj$OcI48sk/sxaQos+[ ~fyF1k+
+ߓR?loo6uKā[Sښi!c Z6JZuY3 ֕s>.Eb[3w[6<yWKBPжYi) Fʚ(8 
+]s[3y[6*a9X:y\u?&XXq%mlY3-ζr#9<dE9]8Zo)x;ͬ흽V7 <LǸ8AN
+t)O5E9I1~6:ʲbdidbq ;{E%=y_U C>Nh<kˋr3co^dki|`ʶpZO 3!Ϋ *Z;܁\PF"jMO0n(~(%."sPZjқ7ii`+
+lݦqūask(US%Ќjq|d*kM׬y5cXq^x9\ajw\Co")hfUxwv`7#yW-[4L f;3OKW&&[ #R#>ګ<{Y
+RsqΛ}=cEV
+KG;(2HAX{fV5Zcoq\錅 \֨?̓L`<N.\ۢT1qp ̜— -=zq^b۱#h}]m턌YˣZdŅ&A&g߸EZAuG7ȸҪ&8Ġf4"u<Hlm$\.e9 aXe=L 3\a еf&1E5M}IzqoM1FUMh~Yݰn0^9Cʚ9sJ+ <&1-YQYu}3[߸ĸxb ;#9.\ "1^3YCmz^+("!ͭ=oNHɄ⮬%@ = [H3A1li)ARlD7lƫZgF뙓k 7ᬩgdfuop$*rRF47)b:1jA*1TunVZbLx\ ctX/@ y&5k03>ð>]CNnѿ>A =I4xxPS9TuxF5kpm0|2;5t<w<uMmw|}-OB tk+K!Fz\>oejjB6z<|bwkYx+/I
+YtCSk!=4 &s鼄/FQ@Bz:Ôب@kΎv͎bMJLXe~1kC8\Wشy=z-9\  .-F]=}PT#kYX3~"^(vwkK
+'D@ hVQ^h!|Ɵ3ZШqŤU59aim}_IstUM=Acӵ7cuO1z /;48@ :ReYIa~㇩{_Z{v*In$ȿf%T5ճ_97
+4|ZJHoYMc?$e~1 IiHT@nnmk5 ڈ{ 93 U=w
+OLNz_X\ZVQE얶vOPTm
+4jnWTٵwacK+[K.^a0:t)I
+;%M_TRQ 7nv#cS3s ^Y[{? u~
+/劁#B ldLu5ɪJ %ZV^QIM5064ٍ&E.Ҋm7;:{zo3844<<<44xޞΎm7Z[j*J
+sEDpqdl43c4b5
+XVKM+ _:Hưa;s|B"qI_PxjuMm]Ʀ렎jmxjUeEyYI‚,MMJD==\ٶL+lFFN%&hbim9
+9N\/ 84<2:6>19Ux.(3+BNnKEWKJJK\s!;+St>0591>6:2<48;[Zji a|؝5A/ c4t LiVLՃ  '$&%gD"QFzlJrRbB|\\l *2<,48כpuvd۱lЂ:tB{o >$'-!B¨̂ΰl).ϋ
+9-QaC|}|/2t 3`pц&IHKaԪd!`e[3OG'gW7w'˛yr=\]8l{;I%x 'zXFR'wi1"]#llC#cS3s n`XY0Yp8lPe1m K:faanfjldhGP_Uetw0A|ƩѪedp) :T>B7u`AQ: 4_^`BoWzF*$L!tL"V5
+L&TUU.΋|ߨmi]#lX".V'U1VE'ee?&]85k 1n
+q
+/GS0 gs
+486 0 0 480 6513.1162109 7207.1401367 cm
+/Im0 Do
+Q
+ endstream endobj 868 0 obj <</CS 735 0 R/I false/K false/S/Transparency/Type/Group>> endobj 869 0 obj <</BitsPerComponent 8/ColorSpace/DeviceGray/DecodeParms<</BitsPerComponent 4/Colors 1/Columns 486>>/Filter/FlateDecode/Height 480/Intent/RelativeColorimetric/Length 25812/Name/X/Subtype/Image/Type/XObject/Width 486>>stream
+Hy<swk)a,c[ckK]R%e)BTԡVɉD*ʖȖ%[,Jۭ{۹7تxt۹ן13;"""~wLMEp;M&}Mk.Gz#ut8|2",&_A |;Ff`/6^ZdYY988vnbggceE∛Ƭ y!L/Z/]66v]ĹDEvDZ̹h"mcv1]n/
+5!K5E㙕΋tET\Bre2T'Reee-^")!.&JAHq)Ԅ/,80'
+.•WT)khjjiiϙ2MIQA
+Rb"B|<܋9'Y$=ůY1`د0EL\Rj U^q9073562]B[(Olq&3IwbOb$ )()͚vN]\]]f .8oprt_gfJKsScC}]mMu<u5:pi8IDd!1 eJ4U &f \7{nz5oV/M]{N- 8YzrJB1Ii9E
+
+aѲA~vr\3fZPD\ZVQy70$<Sgf^UR^USSF.ȾÇBd{$0X?{P[]y0*l:Ña^
+ʚz&Vk\=}ęW߫mlFa/../ Y#W/FA6pNQA^vFZm.-/灃ZSfK1u:B£q’
+qk{W/(
+_BšFXaAvzr|LxϒLhB׮EΙcAq)m* w
+OF)FZ;CfwO܌i ֦U
+#C\[LPٶIFJ\DP
+wil/ݼUPu1#oIcҟnoixV]Qs#츾pFq?j50»XȸGP]}Q3!fH1Ն]{;⺯ @[m'\Ӧr YO5_?͆i['Ok[;{̈'0#i0Ɔ= u%yB=lM DAx3gi"k`ÇE0s UXVY 1Sç5]4huqC<lOg5"KA<S8cH<|.GZ 3vƌӲ@ 0SO*QA& nyQ JF (+%|ɂ3ygpi;s%ťdaWcƗqbZNqyu}S[5xQO&'aƺ4
+gsc}mUM2Bmeb!QIMʪq,f\SO$c47zd8YOkvuW.[4m63uY#Y[lu
+jۢ>MS\QSߌSb<iG7744ww{S} ✈9ېTQ -LhL 25%H6xs7"UOjč97T<{8Z2صYVJLig:[0΃d-,&%y)kGP\?c|@#qqt5M둶g+13y?MjZMg<@0z ~čV4ΰR[߃ k03<TQ.XH{Xػ\JH.*G}EbL?8WeEz9ےtam ̛Ǟqf<XHֺF$[g";]Me<MT_ #
+U߉sw{c]ei^zbLV9)1lgF KmQ3w IL+k0FęP$'5>2Xa+hq31̓Yd:eCf6^A9%kں#ar_gˋLmwZ{׈A;&&l=k:L֢',ܑ3 k^tن1:緯G^v4W'Fؑ# cG63fχiوd_VUrh[aq=@w[#vkV'8C; qfukSm kB?n٭yfuc[mÜ?9 k;#)693%p'aq ٹ#y7NC8gvܴΞv*')l1X3<|hv^=3WoƧ>kYBg+YӏA O+2oQ⬮qy,nmg΅%%W)1IO٭g;aO huB_sf<Xڸ
+f>wK-I52vXaD] nbikJ'd ټ{ɳN^ףQ#C{Pٲeyi<ءV[%1*5Z^I!/vJ42dUmXa(I1֦GTڰg`9+_@H\Za>]3"?y'r + 975.AU%y rL x`kSkg'Ϛ: SVD#G65 O $F]v4>OyТM]W,uC97<vsH#3EAu%n\65ܥNBX6]SPPTjvuQ
++j{_9<4psfjقʙ6Z$$wuv ]dhq!v4H
+<oq쐪䊥 <9S*.auPG~uWVf79!4ɱW.X@9oX#
+56m\%e!jl^ Gy=aکB9SAZl`0'7fvcPAIOꚻ Ga>dnvM`GE@ z6u]c WBn!5ؚ_ĝ|OSݤ#GBCYBEc\ELddI]
+-x ),Ckɾc_ᖚ~s;LWg{~ޯ7ZW^9>줷
+Tm^Td2k-wG'n_k~?5?I/# ޼xcJU% dƂRrxW\Rƃe-}C Θkӛ^,{+!/e&Uj
+҂j>s?^Ϧ׵u ךjOh.}{fc`QE%!kZ;y x#!T~p_Ɔ;[k˞=H =vp:lQ "fdrw5@%k֬`=62VW^LJ}YTys 3;d-3[>A@n`V2~YA6,
+jϩڠ$')&"p?lnL=IiMKg?dd~? YhUܸ b-d_p̵@[Y`  Qwrw1T& O!oؤ|(w{ UWE~J lkf,0
+ dC
+nAUi_9YPL ǥdP+h=\<8@XTOg\ #`ePAsrv.(\95,膋*?3)6
+CY0iO~phMZr
+
+EA1Ow4UQ)jamU3ryA^kȩ/[
+L)CemvպmιmX{W?x<tV_CQ0z;}ZPdjA舢2 幉Of{R[MVa FQ/ai&w%w~ zB춚1\-T~elz ̝}gU^͠M4WF]xZoJ |1 xOD_Oce xX#La`FՋi ^nc3ն} P^Ő:{(ogs Eq~Q/Z6^Q9TR *[z?gzj`' o"SFLZQ̜BR5I98> k w@{mI&"`Fvnزk4:y?ի 5 poseAJdUS?o[5^QZ'l܋HzתqHJܭ~9c+'2,8s.7Cb^ gNަG~^y1^6e  e.aUvW4yCܗ69 )NfeLFYBiøA2Wσ}5fQQ1Z@X|OӇ<xMٜRb߰tI(s(.kEtM3)J/fMʲj:fW
+ZfFTE~ʳvڪ2\,KyY^
+|l ZʞCYFMc 3t!="%DGʞ~#K72  欸\hȋ2lXHQgQ(c+$Z+ Rfcrx׎[_k֬zZeqF9e @Y;K3cB|+u"TBҪڦv^
+p0n\̰{e`Sw (c)fOvԕ~#",q/:-[vkZXPNʞ8M;V(Io^ #*OجR2W@{mq`&#LOWFf#+T
+.l:&NhF9\ڎA
+h_kUAӀ+7f݋WL^M=f>i"a]fL2(9ڥibͨmc{a+0S#y1_q3,^>!Ȍ30/_<=9>؁){SmȿP_pae`똕݈ʖQ00*ωu9 _6^[TM!zUR@[!g.F݋GTn99(c,15U_
+ Sj2BU6Z؛<d|᷀gm{1fȿZ`la!/JIe)Gz^̬Gzښhࠤf081w&,;6ua.W69$wizFՠ
+{Ak2?鉿NA&63N>exȽ>ؿA^'g [Lgd$)o(llЛPeRP
+ [Z0ȿ*;&,T>q=Pa1g:eG
+VvSyŕ"g@ac4KlRas6(l\,{6 <İAac:l'e9YHa3oW4 J̫'w.[EyXUk@SHZUwHlVYc7(lLi`GmqzTv~v<hY38(16CƲoSB^0#gO\q+iE5ReT%>s;oOn7 =ͺ3iG حep҆n<(ll\5EiWTccX0#gKXV][a {G&᠕n(|຃- (#Kw䂪IPsbCnBحKge-L:;C;*:s@ Prʞh*Hw4BԂ>9T.vT(lz"a8#RƇvJ/x./߀&{-|㢙 ƯfYVYy}RX>023޼ u1?yY6
+~URׅ'y|0]+#‡>˴Ig;$6>`Ga?Ȗ"J^Ey٘|0~J
+(KM%˂tDMPX JzAP09{Mt=g3s]W%! \]H,ffzrż\<js׊XM.^[3jyXƇԲk@tJ~eXB(ў/:b'[ZƱʪygעZ%\j"MA-S2mݱ"n5tZ#\[eg&+Ê[_cd{{Gk< }!pgCYNRĹ'ޱ)(c0olf2ʋߔ?w#{/L-,z#(6m`2$yaf2/9
+,Rm[h*ogVѳr I+i@\R3zKN
+|쌴N)23Q tHA)R0
+RPJM [bߴVy3>q#萂)xwCu%Bl)MLu!~z7= H;JɊ0eU[9l{^nESۙH
+|MyQYOxRNR1_Dy# GDVlxbvYC0R._WބcU3K.Ŕ!e * ;,!)Õ`xe[[YÓH|2Nգ^!2K;2t!*`kLs PDʐf2=5eϐ: _EqAz*҂dxg eW#(YH*Sc=r;Q1=Pn)L tUƔ*3q
+JӳvK/m@ʐei3Ph.HpQ
+i*Р RH$dPdqoEua۶}z׿ps}m7Аo?*hZ;܈{KkhW[*?޿h.+H&6^y ;^M/n[Dl}yb7aj<K4 e^Us7yd ZFj}s]UiA.?ѵ#$;~&"ZSЖ:˲߽tbeR9Yh-(ga򾢱D ZO;J p۳yRI-s!k~΁oPˠfׯ>^[wd?3?Y8T_| -e<}h8;3-sK,]cxے+@ԏ/_u6R]4ef>qUƻ\QT7ZSF{ZcqڱAS^H-g`f_$eh{3/#?d'prwSUWO9ZX"H2$Ll"v8^P38^)R1
+"7%&źB[f^/󪚺QG@g}yNRT~s]UiA.yZfd]gpLJnEc -wԕf=s}fmIN.AiU]QIQT{mqfBQ;5, t-wf~
+|1O^ OSbB,kztu֯F" .pG]gN7UAKoQI9@pxeć3]Tr&/{"ߖԶ CFY.Hli E/qƻ\zK+f\:Ɗr2Аec&_4_qә򪚺`q,e?q`7Y+um^1)?5taCh\lZYf/Ζ}/F>*7 Agգ6,<aP^cȅO@ ruYh6H0)hmtf"fgb,S 惞90dc;,\Ge.LL7tD$-m3{BnOlYƶnƽ Agy{!ގV2mEWlSs+Hx?kiֳK'f#$\oߕudc;5͓ڙY*)2,<R*kMw Ka;)$bSeˇ84R}afW\ih}*$
+@63Ge'EyܦDxYF+RAI(A˘
+VJwcLZ0,S)VnrO,irhO(UJ*#GU0
+ʼs)i8a^U6/19 =ODʬ9u#- dD823/U~A/8X'{ T"|f
+ _;O_SSoY'ポ^ce.+|!c7Rs׶M1:gT_kջCKEjEl
+g 4uԁV& p/qR7Z?02!UY]'S,)~vR_UzEиpLX@aΨ̤3wLKQBpA\^dɹc
+Akzrt=Q[.]{0VշDՔխ}#D3ku=Ou1Ql^lL9y~;#*P+MKfQw/BƔ-:eIM[(q!\Y,9.; ]e0R^aLtғOMC_!,
+_'^8Ql @yvL.]vG@čԜ5fro碬WnZE3ˡO * ,
+_ukA63'7ALNhþo>)0@fe͖( r/2\|Rʺ+mw`gvX.(/pF`fc!k߾#)33QV Q9ETt-vhvcI33<e?2Vٜ<@KjF& L ^߿}i,ؘ0K0_N|[afj&"(JOD,(c
+|f}eW`gfF(7U>K;,( >J[Cgd}v6sq47- /jfm{]KysKW/ݍދ sݴJ_,|R:ֻ~eui(`&FڪKrRoFz:n0efd˹+
++{ f&]mg*-B (l̒JfJL-m!BcBpm*~x="`zcMy*QF- &f`/4OȚWT7ݾtv?5(/WHBqg/K5;Pn,zoGn]k!'NeL
+ضXSE 3']S|'͇Q"l׭%9z6AV7E ,$k
++fTH}=Q1/3)&Q/uZ(3k
+]ާrJ[ag3.}]Y<%><`vD$ig*`n~!1Iyag3,}>7-bAg[ =zeJ2rv62ƆoY\C^2.`2z>AH};AA<=9u̴i׋0C:{-wag3,S>.j2bN"RJf u4<3}>婉6}-Ļv}l9 _35ql0 5fR"l<2y(Pt)|D T<Z_M} leggV4v ag13?5^[&#)&ߍ4U/ҙ):`9%U-=CgGΆO_ }^0.٨g$e)mnQ͟e޼pެ_ʳ <q_@ص:F' _3=B~Ȉzîk~M^ 2jz6ާ.|)߿Fԓ{qz8l0RO_gfG=[^c{ÿFJs
+{̴'Ч F^;uUeDؙT2q\2j L`O>`DٽP]N\^}]lQU]sk'Y#S4n^|9}:cME a>.z5~f ,7E%fU6v @Ѧ]fuyW~;QҢh_xgs K(j9 ^sNIUs1|4 v)`^ Yϟ8fw1ݞ2~fDqllRҚ^h`̏ʢԄ W5]ż`Nꭴv<~5Iއ:kUЧ<WUIN`?7)"#}l0 V9{ml^=53bne"MEqs"sJQhC/&(hMG&WN zؕ9%"e~;b`i9şpцg:$o/JyҀ1ŐykVY/>_C$*4!a59hTBqNr!#FNIu{!zwxΓy_ИYUh
+# t՗e$Dy;W_CIfFL3ň9܋K.nBDc!P=m ;Wmoߨ"')71aL10mcӞא)Amzr4
+̜Q(# L\FQ]o'_/mB1
+\+h<$R?c_(C]-%y,kMe 6/
+fxŀhoeaM$2~
+99&ݑ`(#!~(I6+
+0kBqw}E DW]IVR@ y`c'!C/)kS] eYI~䇚 ì28
+Y@e\Շc~ɐ{;kK EyC@3|~h)L/#-dv<6f9oÌsio. [B.cb&rKk;{Q9 z(`_7A _htRfnIMSGQPYq՞`̘G`V
+q32d
+f.~aemuߑ_+@omi6[W.L~Q]Xl\ <},$tM{\}>My_ZZ{j6?d\?a[GCE^z237+T5t|~,ƶ)ôm]_QlJInٜ c&yb@́] NL)mǙ|H[זgq~íd
+U f/ dwukrOGK}%Xku?SN25q/&-~sl6wC cIۦ 2R֍e"]p1߭qj$OcI48sk/sxaQos+[ ~fyF1k+
+ߓR?loo6uKā[Sښi!c Z6JZuY3 ֕s>.Eb[3w[6<yWKBPжYi) Fʚ(8 
+]s[3y[6*a9X:y\u?&XXq%mlY3-ζr#9<dE9]8Zo)x;ͬ흽V7 <LǸ8AN
+t)O5E9I1~6:ʲbdidbq ;{E%=y_U C>Nh<kˋr3co^dki|`ʶpZO 3!Ϋ *Z;܁\PF"jMO0n(~(%."sPZjқ7ii`+
+lݦqūask(US%Ќjq|d*kM׬y5cXq^x9\ajw\Co")hfUxwv`7#yW-[4L f;3OKW&&[ #R#>ګ<{Y
+RsqΛ}=cEV
+KG;(2HAX{fV5Zcoq\錅 \֨?̓L`<N.\ۢT1qp ̜— -=zq^b۱#h}]m턌YˣZdŅ&A&g߸EZAuG7ȸҪ&8Ġf4"u<Hlm$\.e9 aXe=L 3\a еf&1E5M}IzqoM1FUMh~Yݰn0^9Cʚ9sJ+ <&1-YQYu}3[߸ĸxb ;#9.\ "1^3YCmz^+("!ͭ=oNHɄ⮬%@ = [H3A1li)ARlD7lƫZgF뙓k 7ᬩgdfuop$*rRF47)b:1jA*1TunVZbLx\ ctX/@ y&5k03>ð>]CNnѿ>A =I4xxPS9TuxF5kpm0|2;5t<w<uMmw|}-OB tk+K!Fz\>oejjB6z<|bwkYx+/I
+YtCSk!=4 &s鼄/FQ@Bz:Ôب@kΎv͎bMJLXe~1kC8\Wشy=z-9\  .-F]=}PT#kYX3~"^(vwkK
+'D@ hVQ^h!|Ɵ3ZШqŤU59aim}_IstUM=Acӵ7cuO1z /;48@ :ReYIa~㇩{_Z{v*In$ȿf%T5ճ_97
+4|ZJHoYMc?$e~1 IiHT@nnmk5 ڈ{ 93 U=w
+OLNz_X\ZVQE얶vOPTm
+4jnWTٵwacK+[K.^a0:t)I
+;%M_TRQ 7nv#cS3s ^Y[{? u~
+/劁#B ldLu5ɪJ %ZV^QIM5064ٍ&E.Ҋm7;:{zo3844<<<44xޞΎm7Z[j*J
+sEDpqdl43c4b5
+XVKM+ _:Hưa;s|B"qI_PxjuMm]Ʀ렎jmxjUeEyYI‚,MMJD==\ٶL+lFFN%&hbim9
+9N\/ 84<2:6>19Ux.(3+BNnKEWKJJK\s!;+St>0591>6:2<48;[Zji a|؝5A/ c4t LiVLՃ  '$&%gD"QFzlJrRbB|\\l *2<,48כpuvd۱lЂ:tB{o >$'-!B¨̂ΰl).ϋ
+9-QaC|}|/2t 3`pц&IHKaԪd!`e[3OG'gW7w'˛yr=\]8l{;I%x 'zXFR'wi1"]#llC#cS3s n`XY0Yp8lPe1m K:faanfjldhGP_Uetw0A|ƩѪedp) :T>B7u`AQ: 4_^`BoWzF*$L!tL"V5
+L&TUU.΋|ߨmi]#lX".V'U1VE'ee?&]85k 1n
+HV{|SnUHpKK%-J
+i£
+0Фm 
+*/E|Tz, S`2>g:n0@vn}>cs}so.E{Z>w
+w.BS0 H)+g+w]:J`ܟ(\&-$NTT1S(H&C1j(CPn1^ @Q1 dEK!P3.s""FRǶOhA I;SL|`]һf<͖ޣg9}?h2t_9h3W&>ׇ2Ɂ)SULQ9s̝7O,|rQ⧖<tYڕV?~uyao_|W_ݰqS-moλw~v]?l޳}?C>rϞ|˅ᨷNS"O"zl,yIw;ȝW4 !E0 V!]!Yt+gUY;Xu$klYZVڡ+PH- 6yB|!_z(._Z櫌|P(g =Zr![ƹDuqŵ 淬mR l!jho#{z|=
+qDܷnklF<7K,j%M
+A KPXuXpel5\ſo -kPO'8c8#8 qoc2ó88
+!IF1Ym3Y,OVNi-tw)1SmH %:
+dǍpU^b rAFβr9EJvydQ juM%1>!:qYh'40ҭld,p.gF2%MҜ2K^BDmISy"Y+`LR9$u80EI3+4(2rl"(r#8BP x.npXMvICHcȂAq ` Տv)wcN3g`:ў9S
+eW68!7wH+DYQĄ%%R1n+0EF9p
+9a@J c"7.xYݶiQ^ļKws|Q*Ms2]`%
+7k
+UF 6+^Z&ZZ4
+[ˊo44gACo\a7.C2s~Ήb7=ENd_Q.*A@~EͶtjVPgجu0w6sfXg+4 ZunHM FuE0^Mw~w~ŏyG_.&89 I!44
+Re(U`B mQ
+zyv~9Oclw\'//w`O5kC
+
+7Vʊ+{/Fw۫Eu/ :1+yT &t`lZلaXy-Ó9|!ҁ,t 04@œ~ WuZu:H஝Þw)wl8 71<_hh6&m
+zQdr8",߂QcdP<d(i89TJL\Մ#5ᕎz
+lZJe$xۘAcFFKlaY",F!2& DAuE4p#wjWG aF>FA0|\o,O뭌I-u;o~nEyi;i-7۶}C
+vڲyk ?u@A;1ɂ19O.Nې$qS 1:nQGhf$ sې}I3BY6X;>z݁+OM/Wx2Yp>+01n`3KӚQQ>2}j\Uj:n:kL7 yɇd@i33٬/ =ڵkNW~.2Ķ}?yHoⷉ5_.
+uxtésկx[- "Ql3}pEYD0*yRakL"a4BD0_jLJR Kh\Jܻ[{N*>r6a` Ʈ:RN q
+VoTz8 Fj jwq5KWNxyuƍպNKGbop>d
+9B!_ț4b
+U]j7'\q#Qx&/QA5׃ t `k @ =#=@=
+\w1Y 3'$B 2_;Nza_w |x乒olzKc_:CҡC]CDy0<~:G1w|$g<a1V!igE4DS 3}]eFliP[MM=zG<ۻ7''o7nIv"yI f̀49JeNQ((7zc27n
+Kxjd*<ܪ`M&H+/w7^v$)bFoe@c5
+,Yҡ' ZuK6W&'d;T{؆QO6`5m77y5ZZ-49{_^^Z|? }Bدب+|޽wއ{׷Ư+c11]6i]55j֡+Bip*H.U%MK.QSEP( m$h!Xn #}wΜ93sΙsΩԲBu(432t0f7lj2Y_ʮj?ϏĜq9YX+f,fve>|^MbUG{pzvhq=ҩ4qyG2 '>3۬IiЕLy(>zcGa;hƘUFN~hHV%?4m?ԛX}]qR!2=l_\'pVDf_VNU5;TEt8N(G`,Cqrmf?a4oB߉gK:~cEԐ-ܺ'%! wŸg2lȕWdkTYzP'YBdSR:>*o:Z=f%e7-FlZj6xZiYǮ*Gf]18!)k9<ֹ,& Λ;1?#K+*yy>ɗːH!Dr#RtYdOY{Ÿ_WgK_h})Q|܋ , ~&rO֚W`uLkhMZW|ĽȨh|g_1 (B]w: â;g}b{ 6;1zxi^yo~~1T8a50rqW482D\Ԑrh YY*l (=L\kŵDl ?q&Zvً-% u<uʘ8'?&ʃCasYj*c.N4ujcV(BaQ^H^}xb5w9Gs:0HdU5sߒ}sR'][hBMiJ.uY@}J'y1N 
+-$֑(m?қ4"\*t04%ͦ iGyj>ÎQ-GG=J;* 7Ej^+e]KTh>j{Nx}žƱ,
+VkBPlWz,[H'O7ݫo CkKx B;P튆n.?PٶeږbD--@ 0)v
+>BNQ<^#p#5 -SzDCJ*T?2J=ͭmiUsi,2^pBqޠs14ƆI|U΍#e%4X !|,#о@#!NU|7=W/d&kQЃ=T2CДn?̪FArVi |CCȶJ7 >pX``O#t+o';q$-q#
+H|kxW;ϝ}ξ76<XH4!dBTZb(j
+jVjVm->CZ̒ٹs
+i%"00qg_#~۸ubn
+<[݇gqN]bXɜ
+[ eܸ"Arp&Y@Vr{4p$Zad*QU]S9+Wohl60cή K.[bWW֬]7~phxƑMha󖭣? ۭ@w3;>
+w]|ⓟO|_~xC_z_yWڡǾ~7o>q[ǿS:~8?O:Og쳿xz~ ,I600XO! G)8籢.U0rG7 ͈icbKi$C8p
+U@_nK|ϼlm^44onf^0ϛ5_6cC];zK
+g
+l'8ESpwIvMY"5QSctTw_hL&ncd`Ħ Ó:7ἢ?Vj/n,Zzز"j<asY*L\MQbҽK:Cb(3JgzKg:Cb'Ex&<3_UWaz1fY ig>RQWӽJt^`}QF%()_
+$ED<r tSA._Sm6fWL2m^&!,0#$kKb+ /qZ1E,v C$=p(xRzV<G)R^-#ILWMUL\]}b4ȋveqйt~NSeYWX֨s{WK'vX
+u^V<$W,Ӑolʧ9
+찫ѰOd+N"H28yV܂ZE*B[i^J82$1R2Es.˟cUAE6ˡ9]v!OD4 CxS 9y(.q9⏗Rkm
+Bnqyz_^d5'##"7:I$ O@C4!E_=ؖκULeu\Pg4c !:z :Uѡ(Av!nաHT`7)Q.͛o
+#$BU9sE | -[yTbʇ*K[W2,t r0nB1ż(va"ي&ͱ+͢fZ9gL:h줟a܉V,cHFoT1*8+s/ v(f_3srX|6Mnuҍ2kՎэ.zanbx@<GqU5Mt!­ j/Rq{E?e1@Hʧ%|Y87&mulK x\z6jU̳4sx*P;;(BэՐ+UNÿȥ6A; KR\B㳸ZYz#|G[ZGZE8z+ߘyܼcwM9mbM{ɓS9, S*ٿ~ yr#7?VLwW]}&X%kr@
+q
+0 g
+/GS0 gs
+15.8993082 0 0 -16.1025677 7632.3847656 6956.671875 cm
+BX /Sh0 sh EX Q
+ endstream endobj 891 0 obj <</CS/DeviceGray/I false/K false/S/Transparency/Type/Group>> endobj 892 0 obj <</AntiAlias false/ColorSpace/DeviceGray/Coords[0.0 0.0 0.0 0.0 0.0 1.0]/Domain[0.0 1.0]/Extend[true true]/Function 893 0 R/ShadingType 3>> endobj 893 0 obj <</Bounds[0.210899 0.350209 0.494759 0.604521 0.917524]/Domain[0.0 1.0]/Encode[0.0 1.0 0.0 1.0 0.0 1.0 0.0 1.0 0.0 1.0 0.0 1.0]/FunctionType 3/Functions[894 0 R 894 0 R 894 0 R 894 0 R 895 0 R 896 0 R]>> endobj 894 0 obj <</C0[0.5]/C1[0.5]/Domain[0.0 1.0]/FunctionType 2/N 1.0>> endobj 895 0 obj <</C0[0.5]/C1[0.987469]/Domain[0.0 1.0]/FunctionType 2/N 1.0>> endobj 896 0 obj <</C0[0.987469]/C1[1.0]/Domain[0.0 1.0]/FunctionType 2/N 1.0>> endobj 888 0 obj <</G 897 0 R/S/Luminosity/Type/Mask>> endobj 897 0 obj <</BBox[-32768.0 32767.0 32767.0 -32768.0]/Group 898 0 R/Length 86/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ExtGState<</GS0 744 0 R>>/Shading<</Sh0 892 0 R>>>>/Subtype/Form>>stream
+q
+0 g
+/GS0 gs
+11.9217148 0 0 -12.0797682 7632.2294922 6995.9882813 cm
+BX /Sh0 sh EX Q
+ endstream endobj 898 0 obj <</CS/DeviceGray/I false/K false/S/Transparency/Type/Group>> endobj 887 0 obj <</G 899 0 R/S/Luminosity/Type/Mask>> endobj 899 0 obj <</BBox[-32768.0 32767.0 32767.0 -32768.0]/Group 900 0 R/Length 88/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ExtGState<</GS0 744 0 R>>/Shading<</Sh0 892 0 R>>>>/Subtype/Form>>stream
+q
+0 g
+/GS0 gs
+225.9361572 0 0 -225.9361572 7629.4453125 7389.2958984 cm
+BX /Sh0 sh EX Q
+ endstream endobj 900 0 obj <</CS/DeviceGray/I false/K false/S/Transparency/Type/Group>> endobj 886 0 obj <</G 901 0 R/S/Luminosity/Type/Mask>> endobj 901 0 obj <</BBox[-32768.0 32767.0 32767.0 -32768.0]/Group 902 0 R/Length 84/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ExtGState<</GS0 744 0 R>>/Shading<</Sh0 892 0 R>>>>/Subtype/Form>>stream
+q
+0 g
+/GS0 gs
+7.9551892 0 0 -8.0455885 7632.2294922 7026.9384766 cm
+BX /Sh0 sh EX Q
+ endstream endobj 902 0 obj <</CS/DeviceGray/I false/K false/S/Transparency/Type/Group>> endobj 885 0 obj <</G 903 0 R/S/Luminosity/Type/Mask>> endobj 903 0 obj <</BBox[-32768.0 32767.0 32767.0 -32768.0]/Group 904 0 R/Length 86/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ExtGState<</GS0 744 0 R>>/Shading<</Sh0 892 0 R>>>>/Subtype/Form>>stream
+q
+0 g
+/GS0 gs
+225.9359131 0 0 -225.9359131 6749.46875 7454.5385742 cm
+BX /Sh0 sh EX Q
+ endstream endobj 904 0 obj <</CS/DeviceGray/I false/K false/S/Transparency/Type/Group>> endobj 734 0 obj <</LastModified(D:20140918115258+02'00')/Private 905 0 R>> endobj 905 0 obj <</AIMetaData 906 0 R/AIPrivateData1 907 0 R/AIPrivateData2 908 0 R/AIPrivateData3 909 0 R/AIPrivateData4 910 0 R/AIPrivateData5 911 0 R/ContainerVersion 11/CreatorVersion 16/NumBlock 5/RoundtripStreamType 1/RoundtripVersion 16>> endobj 906 0 obj <</Length 960>>stream
+%!PS-Adobe-3.0 %%Creator: Adobe Illustrator(R) 16.0 %%AI8_CreatorVersion: 16.0.0 %%For: (Coraline Lafon) () %%Title: (logotalerv2.ai) %%CreationDate: 18/09/2014 11:52 %%Canvassize: 16383 %%BoundingBox: 224 -1014 1618 26 %%HiResBoundingBox: 224.5146 -1013.7627 1617.3057 26 %%DocumentProcessColors: Cyan Magenta Yellow Black %AI5_FileFormat 12.0 %AI12_BuildNumber: 682 %AI3_ColorUsage: Color %AI7_ImageSettings: 0 %%RGBProcessColor: 0 0 0 ([Repérage]) %AI3_Cropmarks: 0 -1080 1920 0 %AI3_TemplateBox: 960.5 -540.5 960.5 -540.5 %AI3_TileBox: 582 -828 1316 -252 %AI3_DocumentPreview: None %AI5_ArtSize: 14400 14400 %AI5_RulerUnits: 6 %AI9_ColorModel: 1 %AI5_ArtFlags: 0 0 0 1 0 0 1 0 0 %AI5_TargetResolution: 800 %AI5_NumLayers: 1 %AI9_OpenToView: -307 125 0.5 1389 670 18 0 0 163 161 0 0 0 1 1 1 1 1 1 0 %AI5_OpenViewLayers: 7 %%PageOrigin:524 -780 %AI7_GridSettings: 72 8 72 8 1 0 0.8 0.8 0.8 0.9 0.9 0.9 %AI9_Flatten: 1 %AI12_CMSettings: 00.MS %%EndComments endstream endobj 907 0 obj <</Length 10404>>stream
+%%BoundingBox: 224 -1014 1618 26 %%HiResBoundingBox: 224.5146 -1013.7627 1617.3057 26 %AI7_Thumbnail: 128 96 8 %%BeginData: 10254 Hex Bytes %0000330000660000990000CC0033000033330033660033990033CC0033FF %0066000066330066660066990066CC0066FF009900009933009966009999 %0099CC0099FF00CC0000CC3300CC6600CC9900CCCC00CCFF00FF3300FF66 %00FF9900FFCC3300003300333300663300993300CC3300FF333300333333 %3333663333993333CC3333FF3366003366333366663366993366CC3366FF %3399003399333399663399993399CC3399FF33CC0033CC3333CC6633CC99 %33CCCC33CCFF33FF0033FF3333FF6633FF9933FFCC33FFFF660000660033 %6600666600996600CC6600FF6633006633336633666633996633CC6633FF %6666006666336666666666996666CC6666FF669900669933669966669999 %6699CC6699FF66CC0066CC3366CC6666CC9966CCCC66CCFF66FF0066FF33 %66FF6666FF9966FFCC66FFFF9900009900339900669900999900CC9900FF %9933009933339933669933999933CC9933FF996600996633996666996699 %9966CC9966FF9999009999339999669999999999CC9999FF99CC0099CC33 %99CC6699CC9999CCCC99CCFF99FF0099FF3399FF6699FF9999FFCC99FFFF %CC0000CC0033CC0066CC0099CC00CCCC00FFCC3300CC3333CC3366CC3399 %CC33CCCC33FFCC6600CC6633CC6666CC6699CC66CCCC66FFCC9900CC9933 %CC9966CC9999CC99CCCC99FFCCCC00CCCC33CCCC66CCCC99CCCCCCCCCCFF %CCFF00CCFF33CCFF66CCFF99CCFFCCCCFFFFFF0033FF0066FF0099FF00CC %FF3300FF3333FF3366FF3399FF33CCFF33FFFF6600FF6633FF6666FF6699 %FF66CCFF66FFFF9900FF9933FF9966FF9999FF99CCFF99FFFFCC00FFCC33 %FFCC66FFCC99FFCCCCFFCCFFFFFF33FFFF66FFFF99FFFFCC110000001100 %000011111111220000002200000022222222440000004400000044444444 %550000005500000055555555770000007700000077777777880000008800 %000088888888AA000000AA000000AAAAAAAABB000000BB000000BBBBBBBB %DD000000DD000000DDDDDDDDEE000000EE000000EEEEEEEE0000000000FF %00FF0000FFFFFF0000FF00FFFFFF00FFFFFF %524C45FDFCFFFDFCFFFDFCFFFDA4FFA8FFA8FFA8FD77FFA87D5227272752 %2752527D7DFD71FFA85227F826F82752277D27527DF8F8F8527DFD6CFFA8 %52F82727527DA87DA8277D52A87D7D7D52F827277DFD69FF5227F8527DA8 %7D7D527D5252527D52FD057DF827F8277DFD66FF27F8277D7D7D52527DA8 %A8FFCAFFFD04A8527D27522727F8277DFD64FF26F852A87D5252A7A8FD05 %FFCFFD05FFA87D27522727F82652FD41FFA8FFA8FD1EFFF8277DA87D7DA8 %FD11FF52522727262752FD3BFFA87D5252FD05275252A8A8FD18FFF8277D %A85252A8FFA8FFA8FFCFFFA8FFA8FFA8FFFFFFA8FFFFFF7D522727F8F852 %FD37FF7D52F827F8F8F827F827F827F8F8F82727A8FD15FF525252A8527D %FFFFA8512752A8FD04FF7D76FFFFA8A8FFCFFFFFFFA852275227277DFD34 %FFA85227F8FD042752275227522752FD0427F8527DFD12FF7DF87DA85252 %CAFFFFCF522752FFA8527DFF7D52CF7DF852FF5227A8CFFFA8522727F827 %A8FD32FF7CF827F82727522752527D527D527D525227522727F82751FD10 %FFA827F8525252A8FD04FFA827A8FFA8F852A87D52FF7D2752FF527DA8FF %FFFF7D522727F852FD30FFA852F8272752275252A8A8FFCFFFFFFFA8FFA8 %7D5252FD0527A8FD0EFF7DF87D5252A8FFA8FFFFFF7D527DFF7D5252CA7D %7DA8FF527DA87D7DFFFFFFA8FF52272727F8A8FD2EFFA827F8FD04277DA8 %FD05FFA8FFCFFFCFFFFFA87D7DFD0427F87DFD0DFF527C7D7D7DFD05FFA8 %FFA8A8A8FFA8FFA8FFA8CFA8FFA8FFCFFFA8FFA8FFFFFF2752272752FD2D %FFA827F827275252FD11FFA87D52522727F8A8FD0BFF7D277DA852FD04FF %52FD07F827F8F8F827F827F827FD05F827A8FFFF7D2727F8277DFD2BFFA8 %27F82727527DFD05FFA8FFFFFFA8FFFFFFA8FFFFFFA8FFFFA852522727F8 %A8FD0AFF527DA8527DFD04FF7D522727275227522727F8F8F82727522752 %2751272727A8FFFFA8522727F87DFD2BFF52F82727527DFD16FFA8525227 %27F8FD0AFFF852A8527DFFA8FFFF7D2752272727512752FD05F8FD042752 %2727277DA8FFA8FF52FD0427FD2AFF7DF82727527DFFA8FFCFFFA8FFCFFF %A8FFCFFFA8FFCFFFA8FFCFFFA8FFFFA8525227F827FD08FF7D27527D52FD %05FF7D272727F8FD0527F827F827F827F8272727F82752A8FFFFFFA82752 %2727A8FD29FFF82727527DFD1AFFA8525227277DFD07FF7DF87D527DFFFF %A8FFCFFFFD08A827F82727F87DFD06A8A7A8A8FFA8FFA8272727F87DFD28 %FF5226272752FFFFFFCFFD18FF7D5227F827FD07FF52277D527DFD0EFF7D %F8272727A7FD0DFF275227277DFD27FFA827F82752A8FD04FFA8FFCFFFA8 %FFA8FFA8FFCFFFA8FFA8FFA8FFCFFFA8FFFFFFA87D5227F8A8FD06FF7D52 %A8527DFFFFCFFFA8FFCFFFA8FFCFFFA8FF5227272726A8A8FFCFFFA8FFCF %FFA8FFCFFFA8522727F87DFD27FF7DF827277DFFFFA8FF52FD15F852FFCF %FF7D52272627FD06FF52A87D527DFD0EFF7D275227277DFD0DFF52522727 %52FD27FF27272752A8FD04FFA852FD047DA17DA827F8F8F852A8FD067D52 %A8FD04FF52522727A8FD05FF52272727A8FD04FFA8FFFFFFA8FFFFFFA8FF %5227525227A8CFFFFFFFA8FFFFFFA8FFFFFFA8522727F852FD26FFA827F8 %2752FFFFFFA8FF7D52527D5252527D5227F827F827527D5252527D527DCF %FFFFFFCF7D2727F87DFD05FF52F82752A8FD0EFF7D277D5227A7FD0DFF27 %52272752FD26FF7DF827277DFD05FFA8FD07527D27F8F82727FD0852FD05 %FFA752272752FD05FF7DF827277DFFFFA8FFCFFFA8FFCFFFA8FFCFFF5252 %7D5227A8FFFFA8FFCFFFA8FFCFFFA8FFA8272727F87DA8FD25FF52F8F852 %7DFFA8FFCFFD0AFF7DF827F87DFD08FFCFFFA8FFFFA85252F827FD05FF7D %2727527DFD0EFF7D52A87D52A7FD0CFFA8277D52277DFD26FF52F82752A8 %FD0EFF5227272752FD0DFFA87D272727FD05FFA8F8272752CFFFA8FFFFFF %A8FFFFFFA8FFFFFF52527D7D27A8FFFFA8FFFFFFA8FFFFFFA8FF7D27A87D %F87DFD26FF27272752A8FFA8FFFFFFA8FFFFFFA8FD04FF7DF827F87DFFFF %A8FFFFFFA8FFFFFFA8FFFFFF52522727FD06FF27F82727A8FD0DFF7D52A8 %7D277DFD0CFF5252A82727A8FD26FF52F82752FD0FFF5227522752FD0EFF %7D272727FD06FF52F8272752FFCFFFA8FFCFFFA8FFCFFFA8FFFD045227A8 %A8FFCFFFA8FFCFFFA8FFFFA8277D272727FD27FF27272752A8FFCFFFA8FF %CFFFA8FFCFFFA8FFFF7C2752277DFFFFCFFFA8FFCFFFA8FFCFFFA8FF5252 %F827FD06FFA8F8272752A8FD0CFF7D277D52277DFD0BFF5252A852F87DFD %27FF52F82752FD0FFFFD0552FD0EFF7D272727FD07FF52F827277DFFFFA8 %FFFFFFA8FFFFFFA8FF5227525227A8CFFFFFFFA8FFFFFFA8FFA8277D7DF8 %27A8FD27FF52272752A7FFFFFFA8FFFFFFA8FFFFFFA8FFFF7D277D527DFD %04FFA8FFFFFFA8FFFFFFCFFF5252F827FD07FF7DFD0427A8FD0BFF7D2752 %2727A7FD0AFF5252A8272752FD28FF7DF82727A8FD0EFF52527D7D7CFD0D %FFA87D272752FD08FF27F8272727FFFFFFA8FFCFFFA8FFCFFF52272727F8 %A8FFFFA8FFCFFFA8FFFF7DF87D7D2727A8FD28FF7DF8F82752FFA8FFCFFF %A8FFCFFFA8FFCFFFFF7D52A8527DFFFFA8FFCFFFA8FFCFFFA8FFFFA82727 %F87DFD08FFA82727275252FD0AFF7DF827F827A8FD08FFA8527DA852F87D %FD2AFF27272752A8FD0DFF52527D7D7DFD0DFF7D522727A8FD09FF7DF827 %272752FD05FFA8FFFFFF52FD04F8A8FFFFA8FD04FF7D52A87D7DF852A8FD %2AFF52F82727A8FD04FFA8FFFFFFA8FD04FF7D277D277DFFFFA8FFFFFFA8 %FFFFFFA8FFA852272727FD0BFF7DF827275252A8FD07FF7DF827F8277DFD %06FF5227525252F852A8FD2BFF7D27275252FD0DFFFD0552FD0CFFA85227 %F87DFD0BFFA852F8FD04277DA8FFFFFFA8FF52FD04F8A8CAFFFFFF7D5227 %7D5227F8277DFD2DFF272627527DFFA8FFCFFFA8FFCFFFA8FFFF76275227 %7DFFFFCFFFA8FFCFFFA8FFFFA85252F827A8FD0DFF7DF827275227527DCF %FFFFFF7DF827F827A8FFA8A8272752A87D5227527DFD2EFFA8F827277CA8 %FD0BFF5227522752FD0BFF7D52272752FD0FFF7DF827F8FD04275252A852 %FD04F852525227527DA87D27F8527DFD30FF52F827277DCFFFFFFFA8FFFF %FFA8FFFF7CF852F87CFD04FFA8FFFFFFCFFF7D52272727FD11FFA82727F8 %2727522727277D527D272727FD057D2727277DA8FD31FFA827F827527DFD %0AFF52F8272752FD09FF7D7D2727F8A8FD12FFA85227F827F82727277D7D %7DA87D7D527D52FD04277DA8FD33FF7DF8F827277DA8FFCFFFA8FFCFFFFF %7DF827F87DFFFFA8FFCFFFCFFF7D522727F87DFD15FFA87DFD0427F87D52 %7C525252FD0427527DFD37FF7D272752277DA8FD07FF52F8F8F852FD07FF %7D522751F852FD18FFA87D7D52522752FD0527527DA8A8FD39FF5227F827 %27527DFD06FF7DF8F8F87DFFFFCFFFFFA852522727F852FD1DFFFD07A8FD %3FFF7D27F827275252A8A8FFFFFF52F8F8F852FFFFFFA87D52522727F87D %FD65FF7D27F8272752275252A8A852F8F8F852A87D5252275227F8F87DFD %68FF7DFD0527FD04527DFD06522727F82752FD6CFF5227F8F8F8FD042752 %FD0427F8F82652A8FD6FFFA852522727F827F8FD0427527DFD1CFFA8A8A8 %FFA8A8A8FFA8A8A8FFA8A8A8FFA8A8A8FFA8A8A8FFA8FFA8FFA8FD3DFF7D %A87D7D7DA8A8FD1EFFA8FD0FFFA8FD09FF52FFFFFFA8FD56FFA8FD19FF7D %2727A8FD06FFA827A8FD58FFA8272752FD08FFA8FD0EFFA8277DFD08FF27 %FFFFFFA8FD55FF7DA8FF2752FD07FFA8A8FFFFA8A8FFA8A8A8FFA8FFA8FF %FF7DA8FFA8FFFFA8FFFFA827A8FFA8FD0BFFA8FD4AFFA8FFFFFFF8FFFFFF %7DA8FFFFA8FFFF7D7D7DA852A8A8A852527D7DFF52FF27FD057D52FF27FF %FFFFA8FD09FF7DFD4BFFA8A8FFFF527DFFFF7DA8FD04FF7D52FFFF5252FF %7D7D27A8FF7DA87D7D27FFA87DFF7DF8A827FFFFA8FFFFA8A8FD05FFA87D %FD4BFFA8FFFFFF5252FD06FFA8FF7D7DFFFF7D52A8A8A852FFFF7DFF7DA8 %27FF7DFFFFFFF8A827FFFFFFA8FF7DFD53FFA8A8FFFF7D52FF52A8A8FD04 %FF7D52FFFF7D27FFFFFFF8FFFF7DA87D7D27FF7D7DFF7DF8A827FFFFA8FF %FF7DA87D527DA8A87DA8A8FD4AFFA8FFFFFF527D52A8FF7DA8FFA8FFFF7D %7D7DA87D7D7DA87DA8FF7DA852FF52FFFF7D7D7D52A852A8FFFFA8FF52A8 %52FFFFFF27FFA87DFD4AFFA8A8FFFF277D527D7D52FD0BFFA8FD05FFA8FD %06FFA8FD04FFA8FD04FF52A8FD047D527D7D7DFD4AFF7DFFFFA827FF27FD %05FFA8FFA8FFA8FFA8FFA8FFA8FFA8FFA8FFA8FFA8FFA8FFA8FFA8FFA8FF %A8FFFFFF52FFFFFFA85252FD4DFF7D277DF8A8FF527DFF7DFD07FFA8FFFF %FFA8FFFFFFA8A8A8FFA8FFFFFFA8FFFFFFA8FD06FF52A8FFA87D52527DA8 %A8FD33FFA8A8FD15FFA87D52FD04FF7D7DFFFFFFA8A8FFFFA8FFFFFFA8FF %FFFFA8FFFFFFA8FFFFFFA8FFFFFFA8FFFFFF7DA8FFFFA8FFA87D52FFFF7D %7DFD35FF7DFD21FF5227FD0B7DA8FFFFA852FD0A7D5227FD3FFFA87DA8FD %20FFA8A8FD0CFFA8FFA8FD0BFFA8A8FD3FFF7D7DFD30FFA8FD4DFF7DFD80 %FFA8FD14FFA8FFA8FFA8FFA8FFA8FFA8FFA8FFA8FFA8FFA8FFA8FFA8FFA8 %FFA8FFA8FFA8FFA8FFA8FFA8FFA8FFA8FFA8FFA8FFA8FFA8FFA8FFA8FFA8 %FFA8FD31FF7D7D7DFD13FF52F8272727F8272727F8272727F8272727F827 %2727F8272727F8272727F8272727F8272727F8272727F8272727F8272727 %F8272727F8272727F8A8FD2EFFFD04A8FD13FF27FD39F87DFD2FFF7DA8A8 %FD13FF52FD0FF827F8272727F8272727F8272727F827F827F8272727F827 %2727F8272727FD0DF8A8FD45FF27FD0EF827F8F8F827F8F8F827F8F8F827 %F8F8F827F8F8F827FD04F82727F827FD0EF87DFD45FF52FD1DF8525227FD %07F87D52F8F827FD0DF8A8FD45FF27F8F8527D52FD09F827FD0DF827A8FF %52FD07F8527DFD10F8A8FD45FF52F8277D7DA8A8FD07F8272727F8F8F827 %FD09F85252FD08F87D52F8F827FD0DF8A8FD45FF27F8F827F8F8A852F8F8 %F827F8F8F827F8275252F8275227F827525227F82752277D272727522727 %527DFD0DF827F8F8A8FD45FF52F82727F8F852A8F8F87D27F8F827F8277D %2727527D52F8527DFF275227277DA82727525227FF527D52F8F827FD09F8 %7D27F8F8A8FD45FF27F8F827F8F8F8A8FD07F827F8A8F8F8F8A82752527D %52F8F852F87D7DF8F87DF8F87D7D527DFD04F82752FD0AF87DFD45FF52F8 %2727F8F827A827F827F8F8F827F827A827F8F8A827F8F8527DF82752277D %A8F82752F8F8A87D7D52F8F827F82727F8F82727F8F827F8F8F8A8FD45FF %27F8F852F8F8F8A8277DF852F8F8F827F8A82727277D5227277D7DF82752 %277DA827F87D2727A87D527DFD04F82752277D5227277DF852F8F87DFD45 %FF52F82727F8F8277D7D52277D27FD04F827525227F8525227F827F82727 %522752F8F8F852522727275227F827F8FD045227F87D7D277D27F8A8FD45 %FF27F8F827F8F87D52527D2727F8F8F827FD1EF82752F852527D7D7D2727 %F8F8A8FD45FF52F82752F827FFF87D52F8F827F8F8F8272727F8272727F8 %272727F8272727F8272727F8272727F8272727F827F8527DF8F8F852A852 %F8F827F8A8FD45FF27F8F87DA8A827F8F87D5252F8F8F827FD0DF827FD0D %F827F8F82752F8527D7D277D5252F8F8A8FD45FF52F8F8F827FD05F827F8 %F8F827A8A8527D527D527D527D527D7D27F8F8277D527D527D527D527D52 %7DA8A8F8F8F8272727F8F8F827F8F8F8A8FD45FF27FD0EF87D52FD0A2752 %F8F8F8FD0C277D52FD0DF87DFD45FF52FD1BF827F827FD1BF8A8FD45FF27 %FD39F87DFD45FF27FD39F8A8FD45FFFD3A7DA8FD44FFFF %%EndData endstream endobj 908 0 obj <</Length 65536>>stream
+%AI12_CompressedDataxr$7 m#ͶH^۶fdl$+Uul혌dJ%ɬjww!MYW8s_q3m.o~WW>arc?Hxy{;~<ûޝ_]\lޜrŗ/.ǫ۟nϯ.b/8'q:c~,v8Ǐ?G~ywync|ehF_.pq ;H&trwwo/>~^}f?/vquun9^?/.>B}݇O/w^6ᇳ˫ Xpt%f֟>|`j__C0
+zW.߿?\ yݧ /a{0||3)DI:<
+h9&twD@Tf`x1s:l
+G[:r\
+l0 qO~`
+};oܩ;q[w&]pYggԞح=dM6dY G֨b(|\<Xg$1{JdE2ELK䖨8ycDSZ3sEAANv[QEB9KrgB9$ f!N аPqB2)=DZ255E@Q
+:r "LDÉ8{Dr%Tuq2`,NF$["2c |04X"3XZ'Ds
+(I>BD3
+;*,14R̠'LO;`́qʥE@%(;ju <PBB[*߱F-eB]?_m8QSle1Y-7si6Ɗ`f=ٸz,ᩦUkYv@a&'>, 2˜ KԊhwUt"[3* :G&bis8s0=&?*6"ġIz5-}qnA5ױG7 = ڝݲiy<hgesVюݟyּUpw4N6k.Ӳݮrd[*iq+vw;QirDڔY<7*F2 Ƿ-6 f^o ކ'Q5T쩛]W$R(Ϋs:4!J6DYl]TՖH۩"Zz*= -b?kKD^/<-v o6I!7{%.TpJlCvo[ncc0s|{℞LKl4qMzC-AGVMqx%%v1n뒶qDףBv%e{t2SdJ6Ua-mokwf(o[5;#FCPx|hBCvWROِaX;<KbSJyҦ })նmL"7ښٟP6d-fyņa㨡 =GOrsul:zζ#w<"zTuTix1U_Hgo$u}
+]g>a;ׇjqua3>P_vSOZަ}}ہ_K:?uIlog늙nrSS#s凋%ebåƑ)|l׶|Z^[wS-09U
+qgq޹jJ J]~JISt5' <1Dɂ5cdb!ؑyĺ &O1)F4
++~r1YѲjy\Ee\xH#%պe].Nv8-δ
+ ,1Jvf]b"CIsaBEVlhs,;Bౄ6F]6ҭ; G JG#]
+C
+֐=뎯%Tb>c[NM~frĝyyxr'(7cgڱe
+ۮ~3=[~1vyV}S1K0\K]_TqQ|f9t4=)69=Òg_`~USY51#iD!T9WL 7О#\c]33
+/ 2 4ܿ-YM;Z`|P 2کpi) 蛆{W>FŇj^tpsrOz;=l|ZZ$C/:t9Z\ iXE^{p٧Uz
+">c(p,/D8 o9A Zp;ht}ςu:l*! Бf>-VqSQw33w?ѓ%!4XZo,M,m3)s0Q ϹV'F)%fR/^}dPR
+ :.h %7"bAFLԴVjׇ 2$,Cd,K8BJIy]mO*ʴ]i=#RZֵ4I,/_.YVdP4WK)Q$,ԉJ J\^*he>=v@V b.,s{r K{9⠘^οY1QvL69.V,/b Tpn1a{0H
+bPѲ EaŽ֬}a[o mLc
+MhF#ΘaۦN28㪘:5h7G:S9 0V cwzLg'F-P{`rK,^i-UaJe")/{*ǖrlKvSo"CWdۺ1;Λ(s鋢Lg֖Ly}+wZV0/
+׫Zȉ
+f*w垏j?밽922kMv-T#{`'L=ªE״ZjPpM\Kc9 ZEX0ڲ$Dځl%Yj@9Iw$/(zaԢȯ'vSb( u ^lwm~ f’YNUۑ.;;H'v#t}Q개Ta2TPF/߽Z c$nt]sO@9Աgc_M17V?ʂ
+D~6r+H5|%khy'v{04h *u΁
+ Pkxb5{POUGK]OCRegہ}+H1j|a &lCPIaVzhӲay, v
+d󛪏+J^TYj^;(>^
+>(jutFGTA`s/o0>ƨst1)kOv âg.&ОsugSuο:rEڋwϒ-8u&A>LL|vqY{ e|SA`U~:WjJSёDvQGT\vrH=PRrLG%!?: jN03ʁ<VɱC꩞1OeIG;4,0L'c9e#0c=Q61qYG:wX!ʑݓP7F էAWl)ؤw Zdp,̃ ^M1$
+P"7&z}dL:$Bxch W>[q݉t,WЫ/;%y߾CqZz}RJ3 ֒
+HرS
+5F8ZU8i|uLi.ˎ FꊥEД-Us{y[h)*iXg;Ю:n< Zuuh"/
+:w}\{/:'WIcQV(z0
+RNFQ<PRq=Oi2#R۷GG ׋JXMձ)mq{F2ONqL^ }N^Ob5 u|q4ll)7"P*Q2h
+-^L܁)>øa}iWF)n时d| fy <F~藎P
+~滻˛˛g? |_6_]___|r(6mɚ1t`M;02W>/jo~7?}Ճ6oЛjncs /ᰛ۫G_ :~8}wy{˫p L[/H<=`c|
+p'L#D2<4Mfi"Pq'-ƺB#q&d LL}DMj`ByDǒ<"79
+
+fTIE,n ȶɡAY6ʓ
+LK
+H bQ
+^EICD0ٍ
+F% Lv lD6CcР"A1,pWB̈́4 `EHlQfAs<4*3&@UrQ#܄aУ-T9򏃎ދőXMG` 5 ^{KO1Bܠ>".A_Rbk
+ΆGE
+/|8q@ l45QwBT& 48S I E5_p6dF@p!Ĉ
+,>m$ OF  pVP ڡ-PmhF!c0Xd6lxbVX
+iRY!
+|nUiVMVm(X ELm(mu2rHLBVq+헀HCUhRGP4DXXӄ>TJxt%a5Rx T¹S#':nT[Bd(A:BJ ԥ-20@SԩNyt!}cSCERuh
+j LF60#%O!KE40
+J%1JP
+>]sL
+D1J&$ _"R菂#RkQ
+!EyH*u
+aPGw޶Q(hH BA2RPbP2EEن
+B_'3s~3!JrL|-&*dJ ;H #6c 2Ɔ2 ml\˻Lx*B}K#ALO
+p4VJJ7&8|#hIiѡtFs
+otNΒotp f4߈T)F* P7:bp_o6KHoП}oDC1ohd4ΉM8z4@,pqFHaL"iN8:PT@Quq9k/YqY`\&<kڄ#>2PO$]@uqtfMȩw80gf6G&4QɬԔ\rt7!{HSqI9n2ȳi8 ("GjBi2r4S
+snեa68:qƈf~#Vqnx ՜qKmэ0_#%s(uUkm\,@79^q`(ò%u,bՌXFi'M9r/6=>`g[(u;bev
+M&3#IkbFcᭉG1$%hA@ I<
+ML%>2Q(J 3\%Qm$'Kd+9t%l[6Z K\lkk}f
+◌%d81%gi1%H%q$XmҢ%!92Ҵ%t$VD-P5-
+6iK&mi& KQWJk%aWѴ% -=V`JgW'GoSڲ }iڲ4#}F }iڲD4m4mY5mY^l^,A/M[-눗f-KK%ޥY&ܥY*N4kYǺ4iYB],.MZց.Y8,KJsMKrMs%%9&9ҜeoiβoIʲ4g4gYb[,-Y6-Y,K\KsMXK%IՒeҤeiiҲ$i4iYY,,MZ,IZ,IZ.Y,,ZPf-Hf-K K%YEssKҖmKҖs
+^_e
+6y]l+mBIr~j!y[ȵ'1'Ҥ0*T3 pbDɊhd3 |Hp<Hba$lI؂ m LzB!HYE?54Я)x[0nE}4)Lzor 3p׿]#:yaCJ" &!X3XL\'rj?oG$ ,AasLơާe6ElӤ
+a܊P1@nb7ܳAG\C'<9%X̄D<LjA,oh΢B>T-+Θ
+[4B pE >0V^>(_]k- Ԃt6Y$W""+CIaD3f3= RBlPJmP(|lPiaܧ+nB-'jkO
+0ckɰ *0\zETQi%B60DZIfO-<g3Oopecl)PA+m
+6qs|(DN[ӲFcF@qN\#
+8A@Z@=,V:8pA > 
+w|etյMlZWMoEx%ߊ| "f,DM#c̔ムo̔rf1fV(ݤ*vvT_{o"V
+kjJiH`j1JciY
+{6E4~͍,E@V֪Elߪ kaɵYvpS|Gߊgi~%I5ib ~m
+%ME1<57Q'R*+Ԏ,bWQ`Wqq/rS(*qf|.s8t|9>i,2;wsčuG{\z'9մm1覴dٮ,ey9̲]/&҈{@LOd,]/FF}T_z\6bF|L4:ϫ2Uf$4w^ xn-
++p=Dzp):[ispRgB\|&CvvpphyC/0l턋yR,o˯ LΧ=n*s
+Q{ >kPSYͶ#n[
+
+,m$5,ϓ׬uf0DFjQONE\=;q\tnF_rc5 HZq9D -ȉ—e6/aZt/(Dbܬ"!Ȭ=T@{ubOv$nԅ]m5zk rKXF=a'Mzgu \Nzz{+|$n^Sl
+Ipcqi{xkZ~J ֳ ή\߫ͬwzċ‘ liԣfCWT$֌xGs@ 4nd̊m:n()U qdlx
+ϯYS;5 `x X>nȲ}Usxhģ@<I7MTIHmPO~'tJ3x9? 7o:65tV/Vòoe5xx^۴nj\FCx%R)v:D
+"-{-HC!RX):DJ"bH^KCC!Ri9k44u;Dk"M}"'ƞɻ[X%#WZvBG=Б#C{m#WN`!ksv#F{m#ZEءS)t:tZ/:whuNCԡS)vo_5tkH^[H}ii)w;tZ'`cGBO.Q"1w,HNSؼg;Xk^'`cG0Ŏ;lzήC&סr} 5,CСr} #L{m#`tJ:bNCx#`kXrNCx#`SGbG.Ta F_O-GGqE7-[i7I{R=)tQ4u4{Oʝ'-G&$>“׭R? ל4XO˅L8g4iUGiB f;M3j7t"[uEk{^dǕoay {c5܇=:i r6ˈ_jk4=F:L:\w݋l5efǜ^|zYVu=V#SXgjkV4=쩹?:;ӋUb 5+_scA/ ܿg ?f*bWܿ),}ָ=7&
+S;AWc]xQ̓*\ɴΡTG3!~H<$vI^sǓnpWahzC&AuȲ+:"\2"CߡCu3zR\>GixCF)v+;Jbb@"yC!F-v3{Jbb@Gª6E]:>o%۪s\A+W=){O'-G\Kyc{]SksN1W_J/
+ſ<Q:#pHU<D-M35{<`4*R\mqąC/S^irHfQi20d0e{[o6jƢ0{@6
+_\jm=!8OolV|m[_PǞٵ<y dRyt͘zr~q 쳄~Ю`%*^-
+ܤ̔+⢏+<-__t ݃kghT>ڇz]uզ!Cܹ)!NXAj1j/;'>@ezܫ#^l o:LNUkNP ޯFe%˹,ͺY i/m;]`jxh/fMe6n_AA̹%f
+O<&vSnsm;X͙ڦg M'BSۡ<64{}V ._ n6N.O2cr"O5oSy:f䚆MG3~ł~>bZ5KztڟͶn퉍Gc|(t/!`a1dڦ -ܲOxmF-;JZvY^gP4qTp
+Yt=S89Y`e)Ə`]%aߎ衏ٵuȳ?lZrɰVPD[6Pl$ffZMAW
+vŵYbEmfe'Dq3}."/,:U/o>޼>W96
+sRڳǖ}
+UҘXasDG&k,9G66O۳}
+2}*n9}ZHYU(
+ZTC{fG 1Q\wt٧_+$96bWyZ֭
+NȺa! }Z]\YZQ:ɥX<qAfc3CbϮy~f
+FK
+^ϭsVt,Z?q;a3:WAKayIcz_ٟE%=s葵4 [{vK/:I kdS {I oK/)W~ /D޲y
+}eآW%1t{I.ZIOIgL|wBxm_C6槯f8[0|ݧ?8_|sײ}/K{c? ;XUnܤ0U2@<1؀-o`zSZ]78y hA4J"rP%qS#<nGzN:#QPͿR`|/8~9㣷o?]~{? Yb
+GN!'ȉ= = } =rb9C
+i/r&.%iZ#("-rH`}$XҌ3o얭$C)"GXH`-pU")E_w5jH
+B[UF]@FN\ŒW@ 5r\Fז W֍3r2y4Ox ș*p"YTO$ٱzD5@Aj`ԫ-UHvFFGUGenSq\\IZa)HVlv[j3?abhvtۃR_Kc
+IOK87gdM  ?|wW
+)Ƚ߻,<I_&|33AbH!
+ЧLSa,H
+Dd
+>nY4
+D+
+NҘ@,8*xwʬp3r "_ڲ5F54f|gxif%aakhN9Lxoa *Ef8#ve ~U+[g_7'.l?+d}Xvކl:TvcGeNacxH
+󬄻ҙBvX; =}-͘!f#6V)<쥑,4y`0E fqA`#ƞzesD
+
+YH$E%5xp
+45@I
+2
+6% Z*Q(<
+ rOU@Ţ|)^+k
+74UT gѤ(/"jp#,GaZx~LBwhmYD
+'tԓ9eXA*󢚠])</&~*"jX1psjΓRq$aǃ
+ABH0;)9iz7j,}>BPlݙџiM~OyBZ!֒6KFlL,3&4H AΩ$$,~Ty-]`ɩ$?ZnA)()V|ȖpRqL23rx$Rب"e2^xJ<
+\T/fkhd1JsfCv |p,)p$Q!Ҕ=. jX5줂j1ɫƮQ+T$;_M\ȑ &v'^
+k uh(stvDy"tg Ohi J:. D
+RR^<h7txF,$Rd;S-ńwV>Mqo*0<HT!kRW A c Ƌ
+
+s/2FSb"ҴY`? (06)wDz}:H' fUy
+ɩKJWpɟA Msiàq2%P?Y`<7F1w { (iN2eZP%,sF8vRUOr|Ip)] :%5Ʊ ;MQw&-EPޕűQ"qVs?&H]5F1s}ɒ֩U֩,2*nд0;`)X%PVT3UFTX(yմS&_faJ00
+K
+,I#pq
+,@@$Af2d&{W;>#VR8
+؉-W*MfLuYP){1CoMm V߰+XcH<"C,qHR@F
+z ղ+Xs}8|{q8 KhlrtP)J]5iHAPj-T DVl.S-'F1!8+H 4ic@0v;nhZpY۳A7tѱ
+Zc
+QLB(
+o9=;$y\?/(󒴨лb|6wnt'sž|bu0㯤w
+YX% b5*\`0/tTd\ԣ$o7"
+$*B;(q-Bn޻\ QJ,",&c!`ֈ,01-B3UrK|,d1 Y bƀIe`hS/)\RY7j#x
+K&]0Bs'Pߺz"S ^{nXӃW=~%e#J%AT5^lZڴF{ >ElZ=FAEAC!dޢۆ*4Ch(%1/xW&F@Ћ3co1越Yu1d OtdS1hc"i~28yAkY (ڍL).S~o~(I7{%̫m%`Q7_yߓ-Wޘd~;slwlˣ٬D:3&?M Ql<WoĒ'\/)DWtXqͽ'-[)lA(h}AsPQ5,i ڌUVRz<rqϒz_q pzU%.z*|c`8z_ᬙϦǎzW\v}=~ R ^#&O2U Ac
+m=,(7Xd)`"ESY^'7NklLBnL5bf%4e3n B쭛iўg gw|
+3!t_8x\Fp&Eqf g™(.Z/ Dot gQ|p&*^^8Bv_XQ, )Cf Ԕe^d0 z XcA%+GÖ1
+"^Znh9FT?FZPfG0Sc6.Fl\кlqJNb oQcߘ[/1Ko̾mzK*48#td^:f Y'
+NtY'b(.diR/>$ݐ ѢCbrX5 |H~U2z 2:EUF]((h|v'>6O=[ҷcŢq
+k=;m
+ZJ'xKHuo_Ġͧ翾Rdԍ! ju6%|FB0/*}F5&ԛ_ :+D$tWZR !~czfYCȼ'=E{bSĜT+ǮD㰙)k%[bYP['~TaTC؃+rΊQ],pVDf/{EtVoVSQ~in,rW1XʆBsQ>_6F[E|U\ÆцFCqxFIU6D}mvᣬ#nBbI"WSZ壣{piߜ ۑy;־=?=>V>WO$f#?cNFn ⣺gpFiTonlG73EvhPzIYszG[(ch78O
+Rc5>k}ԣFk]*=Fi3E>/;т+Ʉ
+O;8f=1]֣8?gTܪs1uIu3ږ UH<<wŋZ*`IH;*a,s@d5^M-Ng2Zah>c%s.9h/V?!;}
+\d=b WpѕOBa[
+ n SR(:
+ϘyKGFׁyʽ=ʼ`s $(VƐt2/*9ZoQ^ASQ|;D(x\uwb8Ab5yoZeY^(*!vdp-r,ش%tLSY)6o \`+q*㢼&'v"Kd }Q]P[RB"HQ6Q/7gݓ
+
+b
+"] 1x5QJ[q
+]#
+
+٠#;FkhWy`ϞT0il+(;R1Q`У
+YȢ@(EQR;A`}, da kC $V8"%K#ȡT-;׿<CJ_WkTx]sys;s%2U?deAa$ƺ$W?lUW'*.^psU\dw[%xbU~OG*J(DpWSEQ0cQ&Re*.hAO-IrYHKg'Wc'%.)mz1tSFܜ&(5]Ajߤ8QpF
+]V5Mtū,u\n]2@ꂀyM>+pkJʏ9 $)+) r ͩ* oD@S)D8ʚ;d@*2l5$QT"[3&H몽?Bx d JЄVv!+ʦ " Ds+5(۪"n^t*pHjQᏺF(H@URpokxE䨊 ĭ
+&C
+0$^e ~PuNU^Ē/+:AqVQQG,ep*jT
+ϋ"TJWxM (h<ϐPZr<<@&2:
+9x*XOJ
+OhQ6]HC(X`9n- l@NF fUmfRdCt`d4z+]|(г_A Hb"ǀ̓9' R&0dFyND
+rIK8a`xrB M"$E[ԈyuAm҆c:"A-\vSHnUۥø#(J,?q12@A96NFG1h1e`B9:+:ȍߩQ4P=C̃Gg>~ d @Oh2)M-5-%*`<zxe9L1Z51MZ1)E4b j O?ɚ9*kJY"s kEύJv/4L^ǥƵXVi ],.pz]E%mr!u oۉ
+*P)N&
+VomdhoTYpOC/˓9"p
+nTCgpBRIH/B;$
+$Tq9e Nl@
+hsE5͉xE3:3 b> }A$XKExݕ!XO@ ^
+ &uT\0Lyt7. l ƅ4Za)" :iYx&R)b55Ѡ =!4҄(*:e"<HGiC"4@1( bdF8eg$vuhoʣ1Ɉ!/mK.2Ms tU7)T?
+LHxh9
+Ku1 #-<T& #M8Dm#CMъ[^56|H0H4%VGUȈk&p")IY4Y<2,߀
+,3fEG˯Qڊm?ɵ5S`Ȱ1+^TJF :q" Hl "R
+D28$&_7$V[*m+$0[0
+c :uvDxU!3$5s`{AXqdHwvpGhTP"'n4MY -LmFaz!/0H9)Ӵ]2l6ZGL(0* tq>Qx'cPt`hHGQ S~G>NP&"a$ .P<T 1aJB{!IԺP>AS7
+;B>N8\<$s՘a洡
+ICE=.0"Ow~7 *4XW*q*+6Q dBSiOP^%] X2eäA~F*D
+4T)GN F PNѫ%~]`LGǁGixq
+O[h52*8΄= #qS}\ahP0_hLЬ@M59Nl>f21y}0-d.&* -ލ~y@mO{)i|@f4HD$ݒsVP
+Ō0D'@tlseAq7`X'smF5@qu "7槈 Ԑ25> ="=шQ&` BwI'3D@gCY"Dn&]sdH
+)G)I6bSovEH. ;FhX'!G}7(:g0ʑ ^
+]Y+LHd2N1 *EDxF2g$c0%A]•D\C7OLB&e$`B9\2O!+$N
+bp"o0o8AJ<OpD2I
+_T**ۡCV]2YXy%$wc9}1T*\=y\$*pFzC&'McdTMb.n!Ih8TAD!ILfܱtľec'tIPZ+$$ F, /0
+BL$ּHBP$:H\dTp9&0{ 3pFA$v3\ͅփ'YǠI;dqbh
+^$YH+a+bK\Y[QuEJC{52
+g"IRױ}ÅNgpa2FI؅S5߮KK" Sq't``.p/^ `(ux**qD2YNp9D(+.b
+ ]}"S^'C?O(s]ARIնwoY.$~_i? +ͫ3SIM.Ϲ?dAxƃ\("#x v]A0҇xFE 44d\9WȼWstI Նg@2{_7A6kޢhѼy]{Uq7Y\㮼kif͚5'hyͥuͥM
+_عy;/w0.zҗ6g*0v8y_}uqy6rn. vwΐ'
+羘1?9|~y/?;u^k IVۺЯg7>nt@U0{_CΠ.3wϷ;{8éE?/vpo :%p3J)FXÞ[Lnwv7nqíj_];(o߾m۶m7m X:;NGL}/'Ϝcs:Kkl;wpBum oЗͱ oڱm57nGэd-]>`{kKμhH&
+ނ|rgnΰAz&vk* V-[:k({}SYS`݇7.mxe <8ixHͣzr3.BW\
+0FC1s Usc2$>,:6
+0c*tYYx&
+=YC}M5,'_ZLOx
+nh:٢سwn;7ES8hTa1+owOJnoa0|yk۠a#|̾ w\հy\vS%)ηi/*%&2S5 ĥ- ]v:f1|/3Ǔ5-`̣ wz. f×wM<lIK3MZk :X u>4'gDfpxW61Aoiz ]eegMO>QڷdxȰ쬴⇊Up}R FfV"<٭0,* ggv1_"<-)* /Iʆ-`2uƑ.gXFnMO`s\vNїCowʰ ?;<'+WB|ƗWUܡ}:wfi cԜdf!G@* c^"#'/?/'fe 2 Yj 4m]a!fnA3tPwpXC{G K!‚P×YB߈촞ʭP#b򀬼‘*c8< dxм#Gzs{1B w847jdac8<01<fa&[ Gxa f{G}>zpX"_^&c8\\bp]Fe`_\42//c8Lؙ
+pQI(p śy ppݠI[1|p cФmnIe G ײM\S3Y)oj åԖ1Iڛ3#Ksú\f0\\Zg `NAʰ3 ZpcNpIS;c8@ d (kf1>Ñc8` GH1i0# p4Ñc8` GH1i0# p4Ñc8` GH1i0# p4ÑpGp4Ñc8` GHHa GH1i0# pAÑc8` GHbXd G&Úh1\ '0#<XTÑ0/ȰPp]|%pdb;vaܱs'u й3~՝1 4iцS;u钀 \e %\;u5Aqڌ1\ڲرKbN*c8"U7)'$&%vV;0#^:^-6ppI[;h]ws5g =Y;&v=Q0#]HHѳ{bGpD;N={HJ4oB:DJ39Ac䆶rId GMnhtѧOopФ%0ܳO;w0#&-T{Mӽt2+%opdФe{-wJ=m@V0;<|\ڪܧ~v7
+׻{3#Koؽ$w2#Kotw2pЀ>ڝ- L馷ou)2ءSiu
+%#[z
+
+<Cuo _n0\L
+۶V {F1 BC\{c>d؎-(y#F9=a+*r,OoDAvZ1nӁU xGCg akFCz1[!f 6QY~ނYvƍV
+QU dNf>j
+9dޝ;l0]xi=edྑ9k w6xpZmZ2p{{ԔzpP3-RJfajd 2wPZɌ0 İw`Z>.;Z ߉ 蓤c 3g
+&åO \maOؿ0|=c8 :ß1<1\` G`ec8l\a1Ñc8` GH1i0# p4.pWp` GH1i0# p4Ñc8` GE`1)0# p4Ñc8Ҹl#\0# p4ÑaÑp0p$ Q;1q;s8o3|'cw{axt ^ ] jfk; Õ0`xDv5u
+}s?0q⽕nÝz <dH^^a:'=QY!BACf܁}.,%CSO}a=7q]eegMOqU>8gN4Wk|rٙgBM]J6k'?P6g2,$ MʾU{wSΟcW1x;;<oW[y\ݴY-P'hѼuWGʹoruF [l&׭3s_\4)DRlH(okH]s(k٪u;^V :uFt+:uJ訫2ucK-8,:kbbReT>_^b٢3& 5%|\qsp_R a%4fV7+izMHԹKR2d K1<<O6,kHFڀ>t/4eOg@̬Pt,'/=n̹^Y[oZG Qozg[^ 12ڌj'j%]Ik; 5=##3sH %W8xtŘq &k|Ą s壋|޼@Сڬ
+z
+|Ecaѡ?ć'O{/.֭{W=9(M ݦ A,}߄1ŞAnYKAA[ueTOЊmI0;p'//;bTQj;v'>2ef=SO͞=t]
+lKTCT >裍7~ gm/y`Jힽ?p;u|ԁ_d{͛fفS:|O?9C U KWZj/
+i{`b5vb Ο wiIn d ,w8 H_` G
+o:$UtWJ=e]AĻ:$]m{xW?O?߮ |^d=!W<[`I[Qwq.9~_ƺx54s8? N1^nIMn%s J~B,*]*u^]E U$Lseŭ ޭȂU-k<d7/+n˂[/'3xxGn'Mtz/\(Te 47%wگ݂"+.,C!t7벫z-H$?
+unY4nN%ey@/
+,o%7'p2qF/a V(FoE[ST(2,IH/x%ޣr!x /ܒFkD*uM%Ttݺ[eȎ*I.Ip@^P]<ѼUssbgCa$.- K{]x|&$eyh ZKƁjDq+p&B+nl:yh1YD:u/R^&r>Pqh:zIyۦ{2O[\RM:Rv+IeDP.QDlX#?i<ޯc˪M2-$ H8 A܊EÅD}!)A/P@5T5+*PD{UWQjGՀ4蹲tsD(ɜ[I_5(
+UU7)Ԥw듔V)ݰ5^y`,]%.j}!W\hӂ<o.y޲1ނܾr&O,.)vIHc%G 693C\I"U%ڙ@)`
+Uhn@= ,y^Q1/Uhh1nj9fB+,v8U*t-3+g+E/lÐUϤ-3k-
+
+bEMӿM 4N9W6t<Epz$6ՌYB5/Ppj9VKtZ7[U_a̢$ěE]9efM"t|ޠOin3=K%ti Z/)*ONֽVX:efM$tl*Mft{ 7~%I4E
+MU?ֻY%tgºӪtK`Gռm,}12K fx`{LW~-d-UG
+hٟ͚8Q[Go6$
+OUKȨTŞY>!0B끶bY"fc[/Y
+gfY4l lƪRՇtfQ%360ӵ3g=XY"0KdzYs6aVl¬"-MX5^2[e0`z^e{fQfzpt2KdSf̚Y5nئ*MU|K5O%6iչ!I!ӛq2fLLwɤ~i^ifcpSmś-eVg[XwpgAUN-j<%Քh[1
+/..(j
+;dU}]_UΨ]2O<ye-r>cz˸&EρIk{PAvWPYQI,CZ}m},G4gSS`gBChiv{ӓEI0:J[͠AwMz:6ߺA5>["͠m`jCF8QoNͪp{;p!|Ј!'7mrDwwA[f͘K:xIfBf+_3憛esgtG}ɧvꝇc=h9SO?N>ྲྀF:<ISgv͘6C~@9O#'Õn"sþɞMen7~LDiܨ{rT]Gs;1Kg͹믹򒳧useÁ> .sos̳N8rNq3g^9o4KΚrW&sx#N82g5ͷ6!A&1uɬkLDnkQS622L~sxѧ;<c>892Qamxt7 >м[?«o=̜ќyE6ab>4̍}<be$s#gȑ'_<9 GٮM4skod^tґ2s]ǝ׿k//Y8%ۥ5v ]y,}7_ynx؝7Nut^^y㭷x9#s洱;u< 6Nc^|ü^$̹=esQH[rKn\2ͳ_9/>ǜ?ů'|W?쉃*C&_G^x냏?לQb g\},[ɪU\Sٜ2{T/dn59~uهpGkw{}ε ~Lgç\~ok^W6>_I9y˯׮z-Oҷ;>^t//_fuk׬Z[gN.gI+4wo*~.|2 ![/os.}ѫd2Isz/ۯ?}wɼ+PR>G^]a˦ +a6yK]1yzUSO"$8bڕ,L0[#e6a>ks>˼섡mGq7?]+;W|O:`
+lsOj2WU'؝́'_+||\f7fs=?Jod'9S%YK̲/4O^STRgRc|k^{JsۃO7$ٓoXfd>08ו<jZ߭E7~%ꭅ7Vl}MO go?Q.0o3I&2ϺAfr62!2TL}]p +ҟݧn>st[I:.Ō<yܮгoyzm=$39fO2Ϲ72-ѽK?
+r?kLi ;vcϽW21{22{#|go9{L{IGo,,z2,aWN_8W?{9W`gJ vK>ٝٓz-QfcYR]SM
+ Aެ- 34&}EÖll
+<ThJ,[ߤ)}`3ݘ__=ˤjyףpٓzcGԘ2^_evLzיf\A-ѯձ Uӹ@7,t&R>+219^Dz3g)R,˞<*/ps\[N=Tu2{;kse>eb,_ohrؠ4hi.id>z]驻7pڨ*hȤ֙v[|ל|`I|W`~9rG>2gF/ޣ{-2sMDo`W[uYG[~<qdtŴ2g\˖/7݋2Sd:'T{AQ\K?G<uk>~{W:,]o<u_x]rߑE 'ç^&z]ן/9`+o׭ͧܽ2KY"JvӯX嚯VѻK5US/?5k\cְhU.]kj dIe2iGI抷{`yڻOwf?b>\هMOeLŽieޠ27xw?Xr{o螫s
+;,_b?]\| Ͼ{oUfl:+W,%~ũGZ8{Aw:Ȳ5zγwҷTcdnDbW<r ^.~񥗖>#w_7sZMm(1,|K_XăwιhalٝΟsO=Y&y8 'hd>ۮ:Cv,"qa /ɇ悮;2{+s]NQqǏ.cna 2?ff;|߮xw|ŧ=rMK*0'ngw7κiM;֍w SvN~w//#s_'^8;ϻcO0w2#qEWd7R <,/?w}9ؓϝy٬}_/<sQ{By'3oWΞ=K?}JA27+If灿f#N;g͞}e3|qG a2+ÜuF)iOc&LzaߝFu,<y7~Jv>casgL05|ร'L;v1vno 9iӧOr1G:lWo2I9xŸzI'a߮3l!9eډӧPCRD ?u'Nrܟ&ҜK a#Ua;[I6;=(0G;hDlږaSt}oI31%#G>hp~y,3_Ws?aޝ2qK-[8mʾ__~d6r~f}7MdoC~&cdnla&קuos`3ۃVz=ɫT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJURT*UJ?*j͠mv6v_5elUf|/sf,s#2x^7jD;={/"5vcȈ=zmnP*b͜?r!csRpsw=y}h=0j-
+7ܾwW~aںvM8yOއdpޟʘ[ <ϼG>d>{g99~>5Ly w' Ze<5oٝz5wϘOϿew'uTNfS^sVۀg__~nݺ>_wK*p']u>]v7'u'gŷ.|egk~󍕹 ~Kn_}y{Lbޖcwf2\vݺWΜ<o s.2׬Z.}/2oxҾ9SW}XRr_h0?{WN>;q)W[l߂́#]>[]N2ĜܲϾΖsi#zb~黋|ʰ2i; rU.wE݉|gMf6欛|{:.w_}sfMIz-O2|Cל|@ sO桗WVe~L栃fyd=Q/=xIe21W6N:q$Daԇ] o8mԠ
+lwǒ3]jsۃO7>]Lj T߉<Tf#Ǜl`~k^wJƻz'sUA"sϿ~;Ot!ۖTv_p+^4Kmϼw>eR*APdTfn[ V*čwr1I "w=/ZeO|趒
+t]tϋ<yә0ͷ2ۨ{~9<ޗFf#sSi]O|錿ޥj18y/eo\a칷=_&1=\dRJ&{RT-nzΘ
+t9fkۙnur+ ~dK5wL_Ϊ5/CU`[zx~ݘOfi62P*pe6}_LfIև̞^ʊ?Ef.e60DVmdM_?DO[C6{C#dO٧QVF}Z?|:FEfo/Kٺ1t6ݒn[3_fs~ռ mЯȇ2L\ÜA;._5ܮ̘$tMsssfE/.ѣLhY|uLO֘"s'715ZcĜn7?Bfr62q̘_Le_o_}#M c1].7TnܶAd2_25Ok[Ĥ?Zϖ=7KpBV XfIl9fO2 ?Mfy98#4236fy埯5VwtQ.]F7_uZTڿؔ}Ozңç^~b\Gw_ۃLüO_ sĴ+dgůKdk)|5?c)Y2rO_^ŧ+\Be }9›]Ge23s͚/{ieFřU?@?t2WycKLKgc.{3|cw:H^l}9y?w^]mWZG6뮅/ފFeҪUw/|eX'yUw/z2`%\=2(| e2޳rҳ?|e3[m K_\ăw\}wܼm܌4g]xm\?yГ-}en .Q&3z)?^';c^t?<~-W3 #tڥrς^q޴#^R'#xڥsn{}Ϳ/;w}2f=jSλr
+kRa#vR-ݝw#G oݶo߬?.?|ĈCks wsȰ#O:{e2s 9t[pv}o\KmٴOЯo{melF&9`=D9j&>H-O?T1KXT=ӯnu줱-~;;i1LuBm҄'=u{rw>uۚg1nI[g#I /?f'L<j4rZV3>\i.4ǵN>qZ7mesxK$7.9w5o6Ϳ\?mw?m5뤭ӞF^//i}
+v+`G0jO({3G~dDn{n^9Lr3HrncR:qҚ/b,7{Yn̙n{eMN48uO<zbkJ֝JYӸ"lo~2:^Y9ݠ=sq{QAaT +>g石w+kY({B;ي*)QmN°s5d0nWa䴻iBb݉n-4H-Z na-+L波*>{H+
+{uCŻ~*>sz{{^&^RP
+]gl^F|:ACg։ 8o4mxi1 }q'!J|PZaYI:_)Հ!*{5i3Tk"2m"5uzPׁ釽Qx;dH34_9Tj"VV|]gutf5w!^=򕝃.\P<'__cӠ=LSNMo'C򵝡ΡRk;+uEVz<: ^
+`[ᦵk4)?.@(ZC&LTȰ
+kMUB^\qUmVղs5Ap-UIVa0/Ը}>ցE
+ݭ{k;C>To*S6_٪ Zf'*u&jVP
+ڧm *ؖPln)o:؃(jۛI_(IP_Չ5͙ װE UlQ[V%[b#{ }\!O3i2Bgԃ*RQWU\+*Vhւ>UcoW[|GQ>
+@Nԅ*@yz9vT1Uj*U5W Ճ UUjA}j+Z>_*}Xn|v^΅:͡ZJTUTsڬ@ZT +ՂV֌}Rm1j6q*=Cڽz!5C^UmԊU2"Zj>Ui3 Wom-RjؖPln)qzk^ې5ĐocwܺIGN:f8чC&!;5k ͙݆4;v`CC:;]ƍ0QZ+x&3?[֝\d?Nn1 75^j0ʝ?4_I"G8q:倝nHC0i=5(=F Fadp[趧iZr ARdZEۍnLGK0 ]*; Ȥi irLh`N6Ej&c0)6HQJa520
+MCq.8C-^/V4E8[{,r@Bm.ORʐ*4b3޳ 5O
+d7@/> #s'XS1B "uf9IXd郅IFЄ*j;lgm6˧<+ :Wqb kaKӕ/u;%u9(r-e "I]re VR C9ѮRLEGK\ec _MԙET +QW2̹8kz>KVsQ((h
+V\VE e<x<ae
+Ji|
+d@s3jOz=b@k 0GEsdZR֕aveFrRRB:bVkLjf^Dp3UR@U0 [/0b\1!E8E8<P79m$γH 4_hȗ̈ErQ*`
+njY @r#t /*kʗaDԪ4ED{˜ga! `t\L1XJ0%M,V/1/Y31Y萩QxԒ ;~z$לiQwFeK0f
+ R2O(H!(` [ Su`z$2.Fu Y\7 |g<*D
+ +U)N`e-2T
+yXѓ)dH7u(`5-IÆ5ee H
+OQsHa󢩺Yd2? d͋c[(!#U3S ˡFǑ,,ފ
+w-ߍiE[!!g,iH%1`{0-\Cu|SܞHȆ@%]k+N-rFK`#\Ix0 /)3Y7?plim.U_`  Z~2UO"Jhm:ƹv
+q͓O_ųrLG/ Z
+qc9bz3_neSjWZ`fqeI\߅2qWtH{m` #Xe\ @2cZjp+ElKpJa9(h܌CP7`+S֒aMGqJNDlcKXکC4,帼H֭$esԘeAx,? / 3AcO#v!2A c#VD4c:7@bo3}d,i2r M^x-Y3u LF
+ك.gdKBZx$ǣ*C9Eż` Kck`NS8<\v"Ds50*S 7.T;ǟ3ʂ>Dv.!#$h}sEӏY\8\+G:8fWqa3F~S# #aѥ^א'q4kc:Xae>
+tPILw ǃ%!
+ |2r\lfX|}#߽,pIvdH-̋tQ+,J4T=cZDbq?"8VD]YO4Mgic`I棐 @d:<VwpΦf
+g$̄x@$_p,I3|4/,ҕr|~YNB/h.3%8(À^{j2rQh$F
+/SzfHJ[@'8 -4VKI3OKQ4(ܷ_?Zy%i9 3PDe$j6"5d43 ")D7AkL8OwO5zOמ3zM_}NDa" hl:uiY3h\aBmnľ
+]`/eG͍5E C5m12ʉcD1 H$I9phmRsT|q(E4F~F0HHP!
+Թs8d.y]~Q|%FWR %* k!$,c.4]>ԳNr#RdZW
+$bC,,pir 9% "Ѽ4,rAЉvûZ,Fr
+zfR rF,^cb>! j:wiY2a({z^
+hNrnf",w
+<sjʕΡ7qy[h "\p .6\Zah3X )| ߦǮ\A!,>0IaJ̐Xa&cfa&ǥA/G ?+R#EIZc#ORp%E8?l欔4mN@uBJ䒂NʁoZ|/T,rsE轅4IH>D
+(burZk$A: "~[a"
+]Z+4o"%- $%Uԟbڸ }
+l3*;5]5% ƈ6?ְV1Po$ s6Q(Õa(ve0a+bs<B÷_cn!cY˃}N=0I|BJ=CQN^^^)ȣ&e͜K|xD<rao,tx
+H<+`&5X6{*xHψ
+@{H;d J
+2E~LQ
+,gH0Z"S`Eaؽ{qةH'y! 4:^]#pϴJֳͬv|(Po[z|3'`8 '
+pH%YY.v0bq`/pvlk^E1xl,NľΓ (`
+Łn8ތ){
+t
+ӍYYƧ?U~X䤲jh.ZQ9b*@ADxE~l!iKѬuj4y1'PdNoET%\JU(cP5FeO
+[8f{s{ri$pF#:/`L 8!dIa3X<0!'_L c2,"T,Z<K  *tߌ""'Fw'p jfbKB$"{ n(iTv
+a\l@g/$wW3'ŷ d$ԥ3z0uf0-E ysbB
+@ce*L$$Y~,л#[G'E\e)\CmeH$_رyٷ״Q7?\J
+18l5vNlhw,d<@(WCk9\XGۗ8tMѿ6XiĊBC0hs"Hd:v sݣij/D--\ d~C۟-4qYfj\l-y;X s I ~<y9Bmz$]k.Ԑ6g$Z㥦M:XhpKh!@:pe,x0.3
+F==YY} Br,TKu˱X=VZжHBZ!C"Y@#AߙJ0nh9L/kȮgeA8&BHN+izh FR) NĖAEp&w%'ʗ
+Q%ho!1$B!ˡʄՂ%?$(F@dRz0:G[,S"V@@8P/NYlmu wc8QC9d!c@;6"C~x\![àbŒ-qLoZrДhsvN}BAQp
+/6si3!" x+B4] ƫYC|?'gI%\A0 2(DQ3x^t_֖m`eafЙAm|‡_+"Թ)5#>: u ]O;?9r@
+x}9x65,'q# d+ccdL|s@5<1JF 8 2xߤTKf!Q"I!.W0rB(]#["$dEr#y9ry#k!ˡYLWT~~:\4Aᓄc5K1.qThQvQ9-b&S0É!ZO%M6 mf8|Үb9t@L`9u6hCHawZ'u
+^d$
+Y(҈*dlra<|96E,"e
+ZR,`׃
+=
+8 0GQ[R "8&ź.<J:-àqN9#BThڦzHhˢ$bXY<zM/VO jGez64}LcT)hU3[rf$m1y+7_nu~Ȏ%:!}=̾OdWB
+ X+5T:Q^pLCET}䩫+$Be5GTb+u6 7{) 6i Pg
+Cc)
+e<M"c)n<d:Xa/3c焳P46,GTW@+͉g.6E]v@DfZ-"u)B(#+d9V ,Q㢲+:612]
+d9miNZK];5 sz
+K4yjG{1B_,5i&j-vg]CTk| ͠P9I*)quLϢ L7fry^g
+Xӏb=.FS/#YƍC^5O;dG> pF+m9O\RD3.5Ej48GH +PAr=5
+d d(jgIs1bVZm0|!=xP1)0,╅m`3]rPc/|@C d$mڔ5$ \"Kd{Q-Pgyz,R׌ UY!iC<(dLo(d1hJ:O#a)donpζ77`sS:-B4;Z(XӸKJAHP ҂*xAW##)
+Q
+Q2aQ
+5KenE&ώrr퍗K8բQq 
+kA[L"YafJ(eSb ,g(>D7&@Ci^a5 'K]
+IX8`v:Qd]cѡ5b]_ⱺЩ[b^׏$r8'-DK=Z }w\BZUZ&Iu1E<(/p*Vhk g$d/z8׵2]\Z8Ý"lmVD3cKe$x&,72x֏͡(G (IO*Y,l)6 :-Oz@.8cPfgQ[ErO6XӋy 2gqI#Ȓ :z^&l䏑d -Q z]'ˌFV?l(bthH +49|.yS;t,GY&=tÉƼa\e`ND[p7t䚊Xc
+UcsZ@Z 'A" ^[7*oD0S"rku+"Ƕ)!!2ld5C98\h,<޵y:H#5 TDpqP)_Zi#Bayk[! D f Y,<1by"y7ZV쉷&Y,
+3$F('
+'`i#vE:da4  8r+OA1IGMOÍ}~@A%s&9&F Oq=cN!oQ6&?ta-vqt G9M(@q0B[ChkǹMb NXFyp0C3W
+Hz |PfƐ04 3 mlzȟc$s;,Q6`iI1bH k8wFh
+ ' "c?\( i
+Y,<| QQ:#*(}fwGdC2,`2yH“^lFA|Cdp" `
+u鱥!3ψDS^( e Qv%L_&z9@`%klXy-P :%nhjeX`=o!]>zK13g80Cy, Q)11Cñ֓8yz]gsG`wj "4{
+两I*T/DX
+~-8
+ X
+
++Bԅ❅@MRVX}^ng/GҖT$:qx,5p,UQL5"jiVL93J8^mJ
+{N5}&1*\C[TӦx͓pK@bz8M6%E0k> /
+Kj.WJW$Q:y8R,,{02c4іsuDc> [Zd@wkEIYգpkX΃=֗:knG\b1Iʇ0 aKʇ#Dl)Lr* k0{Â[dbJd9Py56BEpoˮwDoEldecDtNjA~.iX
+o8E.XvcʔXnGauGK3/48͡5vI܌"u7$Y)nF:ƘwsXB*b9#t0>ԮBX
+jQw Jk(;H)Ov;qGT|<uӖ ||5t>-28Apl@NSGrEA.oQK% _$|;,P|ztb;0Ӽ\2 E"
+Vc*
+F,@ 17e/@<# +mrBˇżЦk^(cY{W-7l3!-XN
+?z))=IJ.#ʀ'|;}+B1p l}ҘԝKuE)plT?q8AsJ\[@3vCaM2=xQw˨8XC̈pG=NX
+m)^h-2( @p*Q,@">(b<egl Y#hKOXB J  0hGp$rLBN?7ݨbx  2ޠgV0R+
+m4S+%!V?qfZ @MEC+0:aέKB~e2t)J1P@ chIe8~F (~OPBq"J+0H)t*nDq!.%(۫o"x7>8 o%H4=_W fګ0$ Pl<R`g, 3 hўuT=Fˮk-~3,h-
+}jT1 p_Lfuư}m
+gdJ-c,@?evGCxFKOzJ`` 14-:`(bNd,s%-Pf d.O`qd81 `60hqҸ^ ЯK3F@7`h4ړ́@f=K :q4)P6)XqP cܞ. YYhހva]S*,,йxu|FV[Px6fц/VGF
+.f /Бi?N4[5tm?[b \e y jIN/1 "Y}kEJܞ3JB2sѼIN
+| /5=ٔ`r !_Por fa'^x=8_ş]
+טQElI::"6s^?Ix uO_7tL}F h`IM!G0"bv2c;[gVĆGL
+4"h
+"2dn0
+lj#bǚ\b Ʉ-߹tGZlkb{.R<.GVgݛn j,u]kkwS ? O!s(K> ߟC?'`[LnLѧG!Sz Yb*d/9H" 앭9;u-j.=P$wt0ɬ*~U}Mjwћhhџd
+-_'pi6ހ7M-ކ4m`JZGFreYI6sЧF}Q$u -B@pBb`9x4S* ExdO_4Οh?}FY~O[ikik?m&M?>ZJ,'SO>ei?>gT="0l[׶[5Qsw_]Z34l{6?Ra> oS>W>||*$ ¯Hөx.4?翳PJ(TE jm!xW+;#09[0)r]<OR(AQ<-P Š-HNa ?SPJ8K~ft6k*<eADT_UO]vo6E$py'6`6[De-P~W[UZnh*J5uɋ28y1,'4
+?Z+&
+{*bXd8Cr 5P5i!q._dIcmV3+4,[\~ ֖XimIf~|f`fO g[SSC^YBy-Jp<gVUgKNrV,Dht'p?y:ZqRm8-qCK$M(ɀہK(8%vhlޱ͢~ <-!nFC͆XC ^4A$
+H!;fDA*шLF[)F1xP/!K1 !$`
+ M=⌆x@l`b,
+-" B^w1h Pp  E
+< V_uq#yZ$^,H))>6tgXU"OI8fEMPnw,zT,f1uxCun` 3 T8ضq74L@ִph"mZ-^h@) DX"`e%!(bZ4K Ϙd(4;V
+fw 7],r,;JӋjJ#m'K#8hCޮuޕހ],Ue@} 6.@׌p ڊ
+ 9lྨ-&,6Vނ,`0^~_M)TODu8&89?t- Ņ"hZw૲Ⱥ/"ЌcAWVo2}4%P*(^E*%mMhA'7U$+2Hw1,TXkN@1e/C
+ ;ѣ'Pe2b(`)$A|7)^!,L]eYO]pX[0o5P&ӅM^ھ("0< c$l+M t"a_I3IR$ cR6X1d_E#<ӆcAYJuc(pÑ
+1WeNmoزsfgg;AU봫N`3ω4
+ͥDylKʙRM4Y _]$iםm@{ـ#U\Pl6j{a#@?mr={+T[jIGtL,6,ꩆ^"'<aCCƏSW
+8zKc>
+ik*i v\w1E)Q$ì VѴVzbG+Qq+~G&]5 co?S<D"mDht.i&/iL+[U^l il kFj9_-?cTչ4樫Û ~ڕ& y,ֶ'kfiKӼ G[-"7%kw:!@KM鮖x!rS?&~BH6yd_:q-b_քD=p3=ufL>0)xǔ1 `踺ʬ:J16 `Bc?AJ5~Et‡rTDV:s5ٯB )SXq/ԕ,] 4XL]SfڰQU/RI|C"EGëC?'
+9m|m8NMyR@CUԞ4iąed,VHL @&0&,vhj21~x+ftaN5a2N\:y=NؼԓSd[o(W>X`lBb5
+mE vVY,2i8Kb.iBUnNZD<,{!Q$sU{siua r-pr?mڣ ^ϔ!as(CܰV2WF )3gXbE+'+I=7nYƼꌔިe"~ 27;,Ol[Ug.%p6ekPq^$8m<1&_DrR{Z<~rU%ͮe8_mֽ
+
+je*5@sY洓~x:'쀸l|!ʄZᢏɳq1]lе{ +>;xIrrG̈#7[./2O'reK=^OS͐sp#W'.z73bcg)//ds+}z=i )ܠ2˜I""rU.T~%c#ڏԬX>,tJ8J-6 MJ&"ո7>#ҙ t9|F}
+Q|D&f.0wBsjH}\HvBj6"pjĠ߁DLuɕ1x&{QT H$rA*{>tga^-X
+ͷi9U{JW@n?OoBz;붹e%~.>@/Z0v
+'d1\]N\e˟u:DÐ{Lnzp^eW0 :]$ <%&r1e2}-
+5VKdLì5QlרE bG1ˉE-j_1 c1r 1Z/{ν^'L̠CD /糾~yN0@wO 0:vQXfǁr
+Q뙵5by%=3@̔tn]<]L34AH9aÀ/O)1VLqO|/6Km͘f->+:f&
+YWY迂)Qk:z<ǽ+Jq{_+De!ތ.fa']7fC 4h!|2G3^(8m |r'A~;F"0Rvrd
+\_礗a k /, w5- "YOV4'z\ʝ2rsK^]CArsZ;2-c~C 5w^KG̀ 
+y}ä'tDc @BS}\b[oHb;Z0Fƴ*Uā }qt;|6`w[_Z-V(}bqI5Z 7__ưɏ)ih2]0#:(AǚlDeYУY.룁&[ًU06(vh'IC<;&ƤnpJ*j3[MrLtn8GܧM9O)H/VpJF/_y9򳌞h*f,j }N+ o!x?4+#Ͷ@EIGÏ, e9 }3$G0[2
+GN$,# A6V
+eՖc| QN'_+`F X˹%9~%A9 lϭQ ʘ9Q`vSj][HjKW\VI5ɽ|ɉ{]&tݿbЪ-cjtSY*L†4Tӻ\Vp_y
+\tfgǺ1 mioO*`RM2dXIRSWUìǿHs0EVeJl`.Qbdd*F
+\@q{6~|z̽J1Ӵ;5 ܺEc=+z~xP_8||No?r4
+% ~/aH|DeZ!gd >^P%?$GdԨG4c@>ƿ1'*+~: S7i?h}uOp;+[^OdSD-U*{z%^d7 _Z.!
+Q9{(M'.2z3?Å xF6(
+R=EB@*K>]}/@b:fQ}cѰ| 0a F9Hy`=y՛*P!oU|>k i>q!㜞p\]
+Aٶc f/Tkw`5Ⱦ'Jɽݗkv9i{Զrp7GJNLWvrvڹ<ӫkκ.\dg.$]3E{dzCړ32`OGY{lϹS{]{6wˡU^\^ws%U7؛*c&nի~s`yOWK ڻF޿D>R}&iͮ[f_^V<]uN;v2#p8sduzr p:bك#I͑5SqKGXsUј\vqKvRivt
+NMTZ8^bgz^^Ԝ&wV:㸳p8[8Ź)%)S+U~=q9gȹp OO)+v(,9-ҩi5aOEN"uޟe:/ a=}sYqV]J3L\g+M j䪖>W']i2~s_Rwޗgܿrӹ1wN޻J{rv]-w0*t0޻gNؽ
+:ȍi?=؃']VO{sOG=OQ3niY@yq7<oEWac7*Њ֬><H=ob^N]'-|L+i޲ _=<n.2ߋj/D `Mʾa=fEf/ҧʭJ[U~w'҃<}>(A}Ċn B $Щhɱp^B8t4WL|2xRE^ z gN{/t.8;!Ǭ5\@R['T P}C/jhnBaݝ9.prvb68.HFdVŧH-#wO l%A_;9+剋eIѽYb𒮒D$y鋐oD$J^<EvɌJΊ6zSRP-u䩷C1:þ\u> O4IVԈYfLw3s?]2YЧ 60/Y;B&b#5 -9?} K˧#Mh>s݉w½np=+<ov}M>-ZG8+B9fDRPWYKR"%bݞWљ".~*;@ghUZ+vZ1&SDzY">Vb΅'ug̫rVJg;{ܽC緙x/Q/>-,Z">&.R
++sy('.ڼR?6dV$S<I6.{?SqT;LuA#@9~MWi<'SLϵ^
+FջiW' }>_gȸ<h O\hYyT[8S~7xRxs:\sfx1KfF_=}Γt7U~Ս5n߮w5.W {j$#} <:7x4Ey8^}5i{4k<bu^]V{C`:c=?^ΥYJܮHy긙&ɳtD/f<ì!j/Ջ"QGٜ"jy2WpMxIotX֒Ƕ k nDuhQ7>Tfb7)6xF[mϥq [=\1sQ vsZ*3x2}h- 8ow#D$P GK(m21Lgba pHq0Rx}ʄGw  "N> Z+9$9쒀>xZz T+ldoopduw0ɸnSEnP1i+fً)nY֞pߩ
+,gB~֢)`9pL{X YXDUY@wbx,Lt\;qiZlq=5"4VF U;>ŽH95bGHX6B])Fz9. ޅx
+Sݍ4zD{SGvK j4#{<[\eZ|am"}R(m#;>Z{Aӳݧ- ɻZ...<[rRvôREYl=V|V]H|*)t{ˎ2D^mv#-ytiJho!EX0=<Hs'\@wHS?'
+9S^.N9Gb߿7w=xuV$c53,aV U %v?o+Ş=Sʞ}yZv4kΖwkS㻸Do)O[|~kj>brb?c.^-3!y@Z]\b3&؀:) NN#ՓUi9JFLuf], ʈ|&e2H9߀fpM`ohςI{P(sX*<D$~s:#Jsȑ[W'^!Պ5(HG]+\+Rf?RGً9uhAw%!+E` y^+RyF
+A2Ꮩh1)n.H'#O]c H߇TFHMlcJ_G
+}>R8+uWu.#bk84A2Zd|u U6BگfN
+ڞ:|8\ ʮg| ^AϽ5X׳lM%0M4,)DݭAo&uΎLd{h+ uvǬ̌ dqQ 0ĒUS[>0 7td$g]sdvuћ\IJ"ʐ :;W߉f0\+1>c1]L&![u~rKZ ")E-!wR8V39 b7a 7ߣzÍF҄ s#MrkVN]+ v}7+qchdCV .<[X7^MIB}kT؊eލG[?y1|6%Φwy7ؔlŴGV]r,#ufSYrݼRo5ͺ<L!+AS+yW^vn}8~&mjƂi%k{'A֮vya{Y¼Մ =VQ`{|5 Zu,o@JzOs,?"V=KTNg+ҍE.Y>c<X'>r鎞!K[M}nUn/<_5iP~l/'QlWDw?b[yem+p7O׷'|6ER<^읾fe'P}+Whcz}GR;> ms4¾R
+eOW6;rtԲu w-pTG-?~;2>̖Z&[ȰK7toy-- G'A=.f>.o>r;tN-G~x-m)[<jl~]+ݞ<7${ؾ^I2=I2)I$'9$99
+4*" EiRD Eݫzw.۔$3g[yӝɋdxTMbTXU6qi-*2
+KC |5pfnեXkOsӵay%R_9 V+$Kфvͣ)ھeXURSJ(R0֯}麏A/6 uZ,q> (krfA3kf(q[,&ә`p5&7mz?vF#nP1R#<Qw~uQM屽M.ug@MnRW
+j܍O' {*z1VVXOSSilii]Vzl&rl:*ë4Nr,],T*Ž^igD5✛f{ a *w7׍^3213Djw%Ez1ཝL]^ԨhF(ڬf:3{hb6r\nE
+sӍxc%+ߍb®cGCF+5콲˝IcWFNdo2Vnu(Wٻy|Z.7;ހM3 YfEV\+zs{Ԙ年XkP"*u^E3Ru'Mcg6$W}vUn7g}J֚GJzS4sVطbU `֚ҋZM<u[S'k#T`A*zC/*OHY85t1yJv1|`x_ƻodPZ|)bnv1ömkmRbk20K׺+W64dQ#K1E惚IZza4o6I\;cqCFyҋw-7b5Tbonf7db VAc_?1sUnM-.47,ـ8NNߝ][ɴlesrn:95kr7&oAW3<F 6"Kt:т5ЙGI9UꎡR947<S:/-GG VCgA'CgArw4 </ +I~fklfo tT-iVzMY9n؊R-1=k2ѯ‭|ɍ2jIexŔ$̖?6_Ŭl?a[ >TMREʕ-ɑ\VAsf9v9l@5a86vѝek\6{46RxMn`7'dM4~cfdc*k:淳Ԓ3r"b9 ϒƭ/vJG4å5y=zfz+'=V,\(m5d!i{1X:3\8#݀z$O &j0QՎfޤg3+E~^i,|{#/ `*Vf>S:!g9"OYKe,lY=j.foS]^Pb=dS/)"UNz<fk,[i떖r@h#Y,[vdO^O6؞]*s%'(%;ƌUi9aes-IT(%LGFa6raが5̱6*vd4Ӭ&e H-(!FUbU-^.)Ɣփr2XT˕+;q$_ֹԳ[ҩMfI9U"cNo-WdO+swАF+25{Z{<vWd^ipcVd|n"hGSZ[ձ"#G ս"Ct݃+"R-jYѬ<{9V9lgZmyI+ˇ#߸HU^F
+sD#60nSբΈl#y4o=Nrb2b9ʸ:Me\]mNp9WWB)l B댓TU^64s#ٮu# px8uUx8ժB9"pxVxx6و?N\kt<sϭ"8K@#t#tc
+6"Mk Ӯs#0UffW*R לP^Hhc^Z1̼6pm lDlleR6Y76׷;zuT!}=S8.2^u+.H
+dn7).`'i3
+#ṽ.;?SriI1
+7ܘry~}ӻ%U3>oV}>sB<gDqKYj??~{XuSU3Z=utY9tFF Qtz#ⵞGi5 NRG)Nt;#Ӌ>Noзh:X:
+F n|J Ӌ6_w4*27.NopYm@4T'L5$N/NLz.nt4?N/FUYb5FX58뱂zlوh:X:Eܠh:ݒHat&F44Τi`4xc
+tNbF:?9L
+Cz-YntChk겜:
+crS5HfZ:/tS^X=#Έ*ݬ5mtg#f_q.Wy]9J@dtWk̘)Uq̝Ɋ|]m vkNfk;7[G_h1f;yFgq8 %h 勡:=]v}'yL31ξa_Ic茝8ZGs"e&<aS9Qx:7AWG
+쒼ȍvXbcFyC)^|!QZc\JTsgN-PA$:R:]X3 [-$5bBv¾v|Z_˰(o3,J^M}g+tߌ< fF>#E4ÙF`8c#F۟=Y;xWg5ש?KxzOS; gIb3/{U6C7 +ƜpGQϭ;Ǻ愻NʳOdyR^CNf9:~{*> {-qh98ZD̲e3Re`l+V%Y
+u.F>n'߲h,n+vW9"n6$\:yt] +k<.Onhs 1l1U11^~S! ӝ3?%0;6LFqלܽyqAL+D!%:6\U>u]* ͳ6ًq<32(MɉtE7[?iqRtzENyjj0ق+s'yMglJnNh2.,{D=l0zr|=mB4ojraؗf}hl6I?BӎO}B:= څ6xՐq/=q)L6:os+~i$w{iaW6t/#Q-wd%ZO폪_QSe <mwQ./Vg }u(/>M7n'3IᗺRKigڭDO![*olX|egrvn;RI"8tVd<rY˝ R6 N18i7g\+dBbr*k-gt2lʝXeηE1;Ekc%i!cõtXJ*
+n _9ogDǞex·)VP>z(5P>o:SP>Ӳr(uʧ%e~SXjgS <ׯf_3 707ɩ~mT߹~sCg*z~P5gR:峝sEzC5\?-gdw3d]s|~epɹ~8OeSj65I6HasuhĹ~F7~ J,l3~S]tK s̯b|_u]oo~Wijй~*rDj}3_CR~[Xz3?O*:,p~:32\?]'~ugkwy|ugk~xY=xxH^<կ"|Ŷiw?|8_y~s,z+~IC<Tz?6Py_UGUD6\?-T?:kābUV0G[j=Oʳڳ6ys̯B}q y|Dղ\?qU1O1S,Wmgޥ<ѩ:Z~LۍىyRW˺gk^Y~ISj=|`H~#3$V}i</>KRT?xs '᥵gYb 9ozntm wQ՟g9l#Xuuj2F$Rgzn1iEUm:dZn%/=e!0rZTKI[J'vܩi}F=ٜaoTڱ˽osх Wr+Կ;M%}S靽H6dw=L$w3_O#mRbwDnldlndv,r38
+x#Kۑid56Y\?>>ΆOzτ{g+ݞ6: :Mfa0]&[{'o칛qO w#6;B]gÎUf1m07=펴nmM0\KONh@+84ߡ8R:GgȠz:HaEVAY;sX{*no G'-˝4r%}_(_s+.x=ZaE[S2ͧMU<zGYm.ݤ+x" ^woyRL q+nw+iYj;j!ϼv]݁{tOUZXϷBjr*un
+$iM#t5xBa+G|~䧿ٯO!(>!]ivc( Njѓ7"\nŻ0""VK9gP,
+{aRHv#!`=^bod)-gonrӷ/ 垾K`:m4,];u_g>w D[䟮{bP>'՝{T$t.6secD[E!dbWZ~"$}Kl;ݻ콝әҭ'sgwӮ$zkr~ř|ΙL[jNཛMD|MnVYލc\eUi@`kmߦB4+<d?"c?Q[̓@_$6v~}4M$uȵ=Ok~n֢Y'hr^([frtLJ^̄z.O] 1h6.=6.ş}c鼵_>!T\\i)NFEшX[T"`RJ-˚ZAٌBC
+XVî]Enc349#'|b+Vi2xzPj<.]cfG<tdSRhG3?@
+P$c/tą Wrsau&"zPONvx(d{ R)!tx6uD~-#
+}=LG2} eYU ь~@W3 crvb7!{O8k^ܒ.?%Wnr:#*
+cBi:ڧV.wGn{&zb}qrnWhfshUR~lT~+mZ&6x|<'RcIgUŊ[:UWd4h/zSz7CD7wh|ngx'SƾUN%v\g|?Fddx>勵bl03l{@D?@K FHIQRSFU}\,Mz!vl!Mݟ?ؓPV}lA 7I3:
+x T9[ oܞmMG}K4 3l%Unq2TNt5E1QH\ Rb:֖Y[O&3͌v@ -yi{IG)!68+Dq즊%a#yr+m]B^Jq gndK_|"O _rg}7Ūtc$#Mt71/it,NoNiOx}xхLt5[TP~vR>F >HԄ[ fH&##%AU?ا*[#m5DT'[H'ltsdʵ!UW>xs6iox"gQ)£B9A*tH(}Z$մ )Ijz<T!a}y[D6@zacjhyvvEF<ԃ~:ͺ"YR^Pi"N$eoty|4S@1ah?dC/;^ַI7w_zp4uf wkTޫ4~', Rwu^'8[y}
+܊oY ǺJ,̄1/6J38ECLcCF=&$,gJm'ILjg6&űgIvVNX"hLqSl=\
+$hq=yT:Q^:{rJ{}t]yUo[\26G^ uq-j;KubW^ Zv(nutP9rמ 3yu#NIܝ |5C:05O]Aژs4-ޓ -"#='v{a?޽(
+aWwIZoHG8&L52ET`yIΓQaPeU"@q6C1ftA9>C[e*HmL2!  C᱃Tx'.Xo66^:m&K^ rsydtup[#j-SCBHr"I(D=Lf0NDb|Ի uz8kY]%Û{ȣh\8xQ( +?'"*p}"I>F:LE>FXMXXf`3 eTJ*MWf<h#_MH]sQN-mvXէz7MqFz˶F QhzzC!u.ʿJ/p>yvlWۭ*?_8Q4(KrA>[ _xt ;R&l.fVI8E[v.x5邦̵X`3r_o?'f}+g`b;~<RrCq0\k1̹Yqxh~YoZ$u#OFT'tP*3vu,vs~TzR1E\"E@fO& !sr\B8[(œErR=&TN<c.I`@b jޝQbӧwMIE=E1bxK5A]w9~U"0
+SV.)i?}OPqoH})f@k%-1ֵO鐢e ᖓ>LqM@δGf].wpg:)󍗼D߻DT*| ʞ-W|doly,:NhVeq]B;ϼ>C ز ]o63l\b&{D&j(GWFHkJg7{##=)& ztCSc̉L~^Jh䠷$8ۃ%#iR
+k
+RnȳDwXRƄ<))h
+6gDcdx'N-yѺ6@: z3"ެ?y ivCX*f{>&D1~Jl
+6_,O7QogUN#^3 Dn/DǮhֻGnnVMOJqqSR1'uH=|Qop(~y6i݇nsӾPURHtfy/@:V5Uqir/ǥT bc|nzzI/_ oLg<-C1'2Tè 1\tѶSpg ri,?d8y+4)Ks錿ۛefKw%=y #?-4~%U/&)my6)H0`c^Zm.+J1cK13y t?#ʻO0Z9㈖UɭTtW|0TFa!;]:9P}C0jf?[^_t5J  !^ːBtSϑQƮNU [G讈't.d*4BnMT0%䷷鹓q1
+/'
+t>Nst>N~uY˻z;DW&K+S;ic
+3j$3@*>9e"DAZN 4d-:ӮO>K5-i?dvCQObU3%bxՓ
++4Zyz:rP[twKYbE`K^SNr&多 eAY4y$
+Dwɤ1;LQdv'HqOy@TTO28L;޳u6N wX-\tVZc#i앿%CZ0N} y!Kz礒" Fe/!Jn{!K~RLωu,Gg]d>JuFN=T\6D `ѡX펮>&[C3j:v)T0<%Mg<r{uL[ ߨuhvKGS?2i.DCc>6dxl07U PZ- J1j,TzȤ˟?ʊ(,xiA }#Z3]k`3qpae.JJx@ǑQ']lOeNR&w"'qAi[)e6~K×->8,Q6z諑Jv̝KVB
+jYN"yU͛Ԧb!qZjϔʙq[oޭOhC R|E!j(ژWd8$؜P?9TuU駠bRjIYoO0cd4R 0Vt2Z{'o*t2d9@ꝟ |a:Gg+
+| I ?C2Ԥ;l7a-hcT9Vs[>2%̚NtieXFҘ0P^w:}Q2~}/^"ӑ'Ϣhw/99":˝Lͤ :N6
+ ӽ>B91RWLB0LQ$Fn !2aa-Iv`R\`dP X$\u e^OD].OEȊhI~o[ҍ@P-ʕ<}K3 iSkYndD" 00Dbal5
+eKBTlp"bB
+ I7Z+d:e>70# |x q\֚{De>H=e^jKE=v"Wor @CNW)&2,pDg0$ⵐ褭s3C~.#(4]@CÅힵti=!eMS
++/jw? L 2jͰXfOld4]Sȣa!뢫B Ԣ.ti亴],Hh(@@ϬDs7\~k NF5Rz"`+w_q+C{J26:3uf"&<+gn =#ܖ`c2d,Z%VK.[r/[j^U &PI *uĂUʣbH*  ַ~f<~m鳱ݭmx+wK<)}9Xcu
+xNgM&>Y:ʥhhH<GB}"a7_R,]`@o(Oý4qL* XC7x:wHify$$$ZM)!y1F94'U\VWbW+!uxDr6r!9[wC֭ҭ]iynKAe㖫mn(g,4%>w44E{EM -2+Rg7ݢ"6WTj6wFsvQA0R+2Zv|Hᰮݢ^wH>gchG':5Eth:{DkY
+J3Zl̃-7Y /vs xJ
+^*WqiӶO"굠{DԢ<mHSYY#^*%NZSR6ҽR\H_5wwn+;گ`ėDR&ax[T/)帘cvr\ 4 dSW4&\ Sgw'ww] 460so w5ֽk=ƒ7bw<qu- ntiv)g&rEv"Wh_܎'+BQAnHpɽudhQW0q#FQݓdtsV_p5wu3,1wݣBxl-?KVS}}:wp.?g+1 Bp`:1TZ%u<tޔZYbu:O~T*|. !i4S(ToCK5v8%e^8Wp0)7V[3ir3СKCY|]^$G2T$]RvbXۃ&UX]}\\[b.Yt{ƲȲ_k[rlDejmMyvr",zvYN.c7hƖi?]jaԟϏòU-RbvVd.3Q:dFNoh능eesU}k:SwUzMGYoA:}{wE^k<܊>!gqLXs:k]_&(Z.?ovKHݛ
+E~+{"_K^،)^XvVJWǎҳ4,4R .G$5Ӧ<,ېzFRْLD"y|:5+iMrgt+0kws.-g=bLw56 y0VX;:7OD<!BVΑ<Z%j9k]L `ltޙ; V;?EZc\c}$ J*M&!TH'X{lhE][d5{S3ilt 猧Rpowc.7t|՚* ȌQOb˓F鈕yO==rb ݧ)-=bRPW њLJw SDR[F辨;='GѼ&Y^T
+X,u
+I(E*_6G:M*|v]#ԡ$ܾiѳvf4uByȹ x"%yWg-Hu؀dRRuRKsò ,?+[R3٪\X݉yau:q1Ңڴ;BK4i$\i{?#7<d#ug+6k/Hx)賤 Uҁ)7iA ѕI!uH7$%ۙc isA {T[忳?Xr7ߑ~hZf1AU?إ*WA-i?֖c=꧶9^
+ͣ{h5ͦ%-^H:/'#ej=!Z_;LSQdam#ߖ]ܸ):4YzԚ6Hi+c,,m }9FQ1FPc6M#^ev?MW#QTpPXrnfɛ<Fr lJWUq+Az=IUF/uYHff$C_Cܨ|uDzF_[zgOF)4p\1;NWʦ{3cb.P`n/K$uoD)=4TF{c|v^; vFM8塯r[D&)b+.-l+x9Dѓ2F6s/1YԗuKS|ڌ}A@1'1S\lqZ3崓K rsyA&E{L/tdcߨ Aᝉ{Xk_*vjG<g1hԯOUh ecf)*ݹ%E ZV[%-e!QS>OUJm*gTe g`*bŰT◲ v3B~IeSʊ
+%؞zBW.&ԼXK.f]ؿOKCztg^I{1,]"^fQM͠u޵qB=&][Is0TDgo8vx_~+/+Q*:^W[F;Bc˩H}u:Fs ԖZ?Pc&UDyXSfunvc %6WVb%az m^4kЉ\WaOuɭ]1
+e%f1
+BK LE-q2,/Q8 ).Hl$X,Am ~(WL5XZz!֙o &R_ ]䋍(5gJw]ۙM/ 'JNTP僬\W+nrRgdz7s䊃SBw({>A^Z,~9GHq+|2$AU&fFG2`=u*IåqA bFP>VH t4[^LGeɢ̛ǞYJZzmr𔥋(Q sFJyNQYLGF<†ۗak=d><=f4NEȀEA@KB7||y4P
+ 9F@θ#*4!
+t/NB+w U]ኯgyiMmtelFGYMCѩehESOQ9&u 6aEt!qq/VqBƮgYYex~4I`m!2e/&A[Qz.!˭fWGΓ^y5+~֘TS42F.4Ixq%bKGy-SkfZ ),־Y.%!.5;Sy!TdpXxMTYP[yXfC<'(M!U1JخėR
+ZFnSZQ:ʋ'gNmq ʯ ӳGlٿ+
+4|%֏nbaTTv6FQ(EfRA;RC,:L4J6Kf :¬!i! J4%ih,Y&La R(aR&a^ֆ%j Ct@m+ιV9;M=OAw~{杨etv?RX;lY'͕àY_yNIsvj1 0Sӊ{lgXw̑{h ;jUvtu~2d~Uڨ6JJQkߩ>wG9?jeiBiZ;U,;j#OnMS}= \di]DIu^Jvz9uKәhs}V Ғ9}w'^6 ڦ tѮ0fSC4"2%xp'Fz`25<R_9r{@gtz|##=N}"B~f}Zzt+"~ =$#]R^z-y\Ikoa-c6\?fD)&*S yFj]?A)T1J RC;=M0zCwz:iCAֱ875ҡН^nC;*zCwz08:0zCw&tuRS OɶN%._1P\i:B@9$m @R 3ޢ/գq=K!3fa44y ձf[=֙C8R߈>N$g}x.tPCn)  ⎀|U>i8H?l%(+{&!}C|ehk{Sk+qMv_8z'vl6zɽ<>l[;~ʵљbZ5+ͽ<~"+5/J\!6H7$ m򿩦ȵt/96AS/kѐ%kBصȵMzx""B4%$7EqG?vuu]qz}C
+
+oqZx
+
+oѭ%
+ 
+
+
+
+o»
+xV
+
+
+ kw$~>Q wGߗ +[WgKf#&m~=z^WySOWoGm͏#pFcG=ơ@vdjnSx>Lo6#jᲁKշQEc+Lo_ϓ&~k^<O9\99& 剏%M;hYFmG<qD#ޡѓX4?O}/o~da3kò?{o㺾Ze4h M!eJQQ(T(CT*)
+P2h̋u]}?CB?kN{-98뺟ڢ85#5OiuJo^|!-)>:2<tF/WǥVfǫ)bԸ7x(9eIS.]! dOdt|Rb,q' M/_PXH{T@nAyJlFAQ|jbܑ7;٣n0QCINzjР3M Q-kdbflЮG''?} ߉Kcn7}[њo߼jnϻv)cQ{wnvu\b9x̨HޠskM55_dcC@h)Yq#O{ߚoR{~)΍s ё׮Fƭ"?z
+h4eakӶ%{5-#1p yJ㒦F]UvޭܧPAnt_ln:UOc9BTi,l\}9qKp/3n'B=|X\w-\r]VXB:bIsU7mʬjF l׬~XbڅwP3oj?BwBJS%ZܷQA9{pOŬi$o=Imʬ.q8.\ֵwU=~RXbvTZ@h^|GElYviطebxֽl6kEi%trn>@e MFͮ|?Ʃ97)軷#;7t:73m9Eg16{8T\FYD
+5j&-ZC2qyMݳ篰U2Mt)_@pDzZcmK0&u Xe-s윽C"%1qO縨<.em{`=&)+,P}b1`ǦQq|)yVͶmgxrXz񃻷mXh3&mq
+cvl0.YϜovö'_X@c)c><й8?ҹ;ֹ[cFi{~b]
+ypY[ۻ q 6ܥ\4;јmݾqt.+s=3ѽ!ȶMQV ) P!(M24Efɴw$ZPWUZxꅔ=A:,636V+9 `GFola토=Q)*,BS#]IO:#rTFʹT322
+꓌f[ڹ<~%/A߼lz~~N`?3'Ws_̶F? }PUB<f_06묜6|e4tû/Ԕݾv!%@_VsrFaºknsO~QVÅlP\ʅkj4xß]Gc m4?vbPUKp9<| U΢ڌ[5`1gBH̺?x>*cx/mg&޳mR(l_Ϣڌ[IJNuᬅv.dozd_ݥ4|nȶQH=kJè&23nK .E ;IȾYXZ7t)#ԞmWfyD59Dܵyng
+~{ل]䘽AKϠ3'*JzFz)<6:q
+[wB05n?d;z
+8js{bD?d#v9qNIe[R xE򢛗]@KQfĠȘLMP(\O3E+":O^u{fdϝڹjqGDEL&(95󗺬߾XJfGͯy0ݫ'U%2NrcDMTYPdyu=c 5Cĥ^+B-pk謍7$ϟ<,ȹd3wDf|ј?s_4*jQKƛpk>LMs{cQ^mkF&*-EFc
+we.zk| jhr~\^u.Kgɑ ,,ǖ](\_Pkz k(V߼'*c=uy.Rd+π=GΣpW! -2W&~L} y\YXɳG'_ạ.hɭd0*j߹~2j
+K}MZfD0!+cNg(,{B̂GdڵԀ+I5#bOg>#rg-HPFIGx:X12se"kODN+/\rr~nn^pdnwDދE.k|נߢFFf́e's@BK7+И ۗjˋXf%';MyPJP'M`jec]EQ^VJLV/$C2Y-f@O$ќ,$25&Cn9|L=gvfTfHV$x T`&*48Ueb`e&3 9u}K/Aa g,3{[̘2f rI-A_5VMopAȴ3_kg>m<X\VUx
+h Cδ7.&fdd#>FQ4}˞hXW^{TTF۹ڊ0csLGV0məyEu Ȍvmٽ'_m3g԰bdllϦ5Kodt#Io"_QDVx2|ZzBdӢY٭5̵uu|naym#0 aճq|VZ詳36S PhP֜<{!Od\WVH֚ Ao_4<s%@/3LNm͂3u$VPw x;ۗĆx,cNShE׶}qiQ"Ze~iYwo^k7%|ܙ $/*^+jG@ı+4x_ A7ϟTeRc<#mE*hwZk$^O:n)nT7K? #릺 xlv3YS^J`KApW<CeW=}=hl.q`LQ&Ӛ $4 PuBnQœ "Xfj;s-Q&?uJk2LV 3Ty-^y#3ӎbDex M5bHZW ߆uxcs} Rbl^h<N`њ8ym Mrᣆ@vlGLSGvnr LbHgf~Sל2oY8^
+Dn/xc3n\8u(t=J`zjdѭY).rZxFq7xB2/OW~GT ORY)/t~ !#>lS(h_M;|*՚sSQSR?cLxvCwY2wdQܣY_,!5S.~$Lv̤a<r`G. )I7"w
+4]mgS+ffT1FUtʯfDHk<PߕƓd{3Ш,8aC(_S~ "w8<vfZ{#KK)~|.+NTO=f\$zQiÎ)WK!u욒[}L' F/A'/ݯnx ~ݙPw#9q{.;Y}x{05ҮݭxCw(GͥSdEXl[/ׅD%e~5\h~P}?I447Ԓ5]~oSTU\}
+<4
+`w.>~I u6Sʣ䴌̗{o?y^ם?85ƎHra2*]Ï^X^ rCugwnt~l5+ey>!Qɗ֋= =*yddMSL)7f͖\4E|ы%x{4DGYV#t)Jy]ӗꞿ[04HKV#T)F7v͖Űfd*~x̰_<moWp)Á#LSB|,jH1 l[
+'ȿ|p+OJ9<2XfBJ*eMiJ ,rk;CMSrqV w ^& >?
+s
+s#M9b|9mpfٽ3(f,6QGSjBluP\0|ؑľ
+>}Ed
+Rt17T;zqRCգIΕ[`>L1זJ<i7oz0E`RV5q-p1],gLP6#q_42_BFA)s?izVK諎5'^Rd?<.FA)s
+OEc,['.| 2+s_5T;gjo5r>GRV<}A]d07##ya&[;1lD;l
+>⽜Tja%cjeR J[$W[,G^˽C Jc:|2dtFfʰ$0~j=sPB)s L`n!;r@[,1liKN)d/nG%y#]'- ˲aѩ
+aM<rҡ es-6xXv?W{/]OٹHsl[,6a2*syJ_^܄Q#s.fNTle󶛚FwƤ]/nx{/mD0왋\6M*
+eXvE6[vk]e=ͬD ux-fټ9Pʦ#_eSF)L"C:H+Ǐ/|KO9bﲝ'(Dl[&7tǨOb]Qn
+/b4 _1Ry/;p\"TnˣϰBsT…𺱦8l,YY곍e|^Ivm`d"O0l#xbf)G}1۲<{#g%PYxf:Jl1ڲ ˽as,ȗoy_hmyބ59PMڰH󍙙I[v0G%Yms[nvBc-zSTf)r.tpݘ[e-Q"kYb[xZ,Ѝn_KlS[7޴ mY3o&W2 D-ރ,*3lL?&kcQڲhkҫlk+g8|;rZ,e Xb
+ČW1;}s_?TtxM~r,EM~NӴ}TgAN_[Yڲ@V^3\$>_;>GS]8[Hce}+ɇܗUj%~Qډ࣊%@[Hc~Yuѵԣ^E/|j5+_^$07dW ;E$~-j"(|B+t6
+_+-O_9%rs,x5aX@
+—@/`es;՚iSxy&eA`nVM]6;y<UKd_MKnGCOC6u# 9v,xJ,"OX=u[1|1^%;u]mq&G›=B=C^-bl|l2IQb/6lź1gUl"/d>c,Onaƒ3<e~Z
+Do"~X)2De<HiA/<آ ٘VMVb<p޼
+hAo?8ZL=<0U0HQ&69-9VH[kLg"v扽k˵8e:)VD
+z·uOR/޸ 'Ru[>D<0 =
+;-_s6eCh`WtZ=FO~' ND  [LW6{
+љc{>5%;QyJmk?Yd $GRaۿs.hU3kB8Ƶ2>^^| .ۿs0UWS{COU"7gW|T9ZSYP2uQ_lƁowx50-|,xU;4:R._Wz~`OXt>*"jU>sxg+*>_SJ
+T=ڠ2,M/Ե/<e>8spO$׃ʢ
+
+|u.U
+* <ɣ3On\/[GT,;{UpWDᄛHpJ*}lѥ V:mxzaQYya# eQ/g>_,\ѧM+$|3
+ Ja-BP\ݹPӈMT&߆ݼ_D*|J=m?@UfNM6dӠ@xCҗԧKsȥ _?|eh&
+_> _Am>—4-|᫵ D٘Sk_[pj`/
+K0~[/ezD|K0~QĠܭGрP+~tي.x| kw#4fQ`'B4d-O/~5 >Ɲ~-B'ǎ:|#,lh̢
+µ C'hJ:}l]e2ܷLesa@h6&W>ۖ?K)L0vׂn>xL_ m&bv:92o!id# m<*PDz9*2C)˖Qџ .esۛnvY4s=G}Ve'e^lٵUK~ް_ز9 mî(|h'2lU2sY'X6(xRwk[ uˆw.Բqʆ]6gJm5l˦S6^]6?r/aK~հ,,F]6$ia-[V G :_NbV"m0lbDZEomwcd({QTq[eP?jߞk_A["1:PCMXvS̖{Iɾ[#3a;YKfZ`|7Fl?qC*es *{~Vs?7MfWf,[l+7={/AeO+f^n6EkBw|~eA.)=셇ؘ(I iaӖݳ`I<2;eܸ_58@ȵ66eԖSp
+P~^aYu4Ș^"׿tgٺE,`)׳bV[O@26{̣PZrΘ4j}!R{+!;ۢ2scwh5<L̺]01nq٫2߲y #`ƨ{W u ًlޑG%_/{Qo]<y p-{ k{32Y9")A1zZ쮍,W[U_rZF넇)}kKo1*nfV0=<L;qG?@1sj#CcqC>F XvOjZrԫ*Uoו_J
+(|EY6_xR՟=Ld
+J87=.e>sfX:m'Sf}J!>+̍41s~{1F}<; yX R~VsFF<و*K%P̽ GmF)b|ux#2
+_Fæ/,FmF콶JʺS
+>(57e/^1D6#f.r&kN\نJb<*ob7#c5 /'Ō;3,j)oۈ3ތ V1Y:3ٕ/6U¥`2e巁rT1fFf
+9WxVnR)$;6=͆bfIF-Qg6 <uf#Af6rU^{mYcC7SR̨3Oiz㮘ԫw9 $z}xT[zRrTÏlb8ryw+X}E}es7㵗we~1y8r%9FX#s[YWi`)31[l1js-n='KSTӊ{bw9/2Qk(eR<DRqB'_{Nz52w.tzœAfr?X MV՛e9:0MQgwnt9IIzmdfΙ嵧~(1jdR~}[ݗ͝1v@_~(ҫw+4aWw.>r ,e`rfvD0E/2EEl^c;[_m̈bqZ1gdlj.
+S͗{n;pbBدo^ddvL0әi>Hٝ~}ur%L|9Kl?i,N3uTFoW l(͗{1 ix]WVk }z^B2fk B _f|zxE)jT񭗐xhg>F xvAYgCk@>Cˆ[YItV>Wʳ(F9;#?gw /^7֖g_cuF/FfϞij}᤬[%5 /q
+dpS&Cԓœt
+-ݷ>W\d^>!兹OEmt;EKAjX:)*S;0*h/X2|*
+o\3ԚfFIȋ_cf.tudNhʫ(/3.7&(13DA{L,FĦ\:xaTe޳P*cFuL'_zG󔆾W |"rLxNJ:hB'D LWz fD zjPSOä4 fQ2mY"_J`i.'1PlEeZf46#'c]S9T_ lOdM0"C##JkSMyI4(xB2k&3D~ 
+o*PEe 5 ʬkat#;m=ew/y2y߸ ek" ;O~PB"7(Uf<PeWf }qYL4'ou#E/1W@Oav!47<*{19((23ʌ.
+k|K )ok\?ttODnMf13o=nx= έ_?Z ZƩ#x8XrS2|1n7x?͹% IUɝ'v4-e60r s45O2X xɕo_9p0oS-<:|*Z~I!]LP7/En\cga./9"YdrwQ'e߾_YH24gtKFE¼3wYj>CWM" ,?sۦio?~Fe0pmG~j'ؽAmͦMR+1XO,(0Iyu=ceOɺq e׼ugwי^܄u I>lN";̍Wk,3}gߠ1r
+V?5^<~.Orcćey2?Tbꤩl|9qN in[WΞ8sլ)Fܗ'sWdCF*O0sˮg*.܀&?ݽ6߭_?)w# Mn M eF +EܻJړgYXsiMu(OܵoehP>ϯ?s^dFһ2(jۡ /ŜUO]2qk4%߾x4<p%I!{q^d̿&*u^-7 "ە3]$[?ZSZw9-!jQF<6`Wz朐v)6o?trWuĭS[j6
+do@23l+ԜC;}z>^~,Pȯln]Fd D38-ԜE=}Qs4:wr:2T?wv
+CX`9wyHGkqy#|]NF-Yb(DKd<`ɦ \|>v]~9w}j+Ks2ܱkrk=ME!Hp- n4g490YvXyٹ L4P\VDbn+MS2nɢA 7Rrf[ٯY-*.jyDkT9vmq^ja2YؒaJ涫6S6_}umј,^4>F9;#)f_yu5eF/&-9<RFA]gk6rFap
+iאY?;rB@_ 'Rn-BMν=Kp9&gd*,~҈R؇uL5dYW=w%=1f_JZƌBٚ"+2ݜ}g!5tͱ^ 9+ vY!#F )qv[FK^z$^w[3Юy*gMP9{ILwmR{i2JĬN y]l-n@6†l7p (VM.o_>$ft,rG.du~5΃FHrin/xѓiY9w0= iyC]Ui᭫RmX Tn@6]Σp9Omi@l7
+J*a<ES?.+s=udQ!5ܚAQFb!>}>=Ҟ_uтD㚲KcXjo=w*A])rhvdh`_pđ30+QXf޶a'h% BK*iMke%l4jFtF9LԌXH7d
+߾,# 1(Z rtg4;W0xb[wF|)73adf{5qog;+lcF FњrWsk~9;pJaض-tXj7Y$
+g5>dǒYˈЧ 2ν~?0%-i.9<*tX"`yV!߼DD5M 'cW ]# ҃
+3`xs흽C"#sV=~،qsQhUvѸe.X
+i85)clϞ<xPx;R:x x4̨a&fͣ϶q{:RZNYKw,𞃱'Ϝ{A@A3BlS\ĪK޺u.90\ƪƤ!wI{*.#u^фȸ/#M:t P#Ϩة_2~\YZwbZ4>?1ɺ?mKߠa(M/w06EQA7QM TZiS772FV}:huOܐYk$tL̬V`̉KQ~НGAIQ₼kȪgO4Vf͇$!1lQ2rʚ:SZ.q\{#qIg/f]R^3J$u?~RĨ<**SǢnt_lns5qo#؞FI)iL4>fdžC'Rҳ=@BF֍UҸKnwS
+Sǽ㪲;73%'DGvh, ݞ)oKɎS|e+|v?r<17 hQ{5͓=($0_aR/7"&#NO9xG&oW%sh*ɐ!#%(ha^hsC@Ȟ HGuϞ% X<|Km"njxZ[SYzRFj#wmdbtJrhv\c _g2BBYQq0&!9kyw/ %(k_R
+Yx5EY)q2-}&.-kh<wA;OJ=u5ݢeU5OiiO]J_ȥ_D
+7<AE\VRTp+';3 8<,m*'i(9t htgoʸG+65Z9hG3\%׌ԔHlڌޭh;KKK%)\ gO<~@x6u.x!OqP:= nȸ%=VQU[gʌK]<|G9vy7*[X'ϚԤXlD5'5}X],/"pcӺՕeF>wh x&ODex_ θAcD
+ZI}E]r%eՏ MH״شXo89Q;UۈH^Jߗϛak*ݽs3 gSNEܻ38`Z"Stƍ1Y5ՠW7nqAJAEcT+V޸ec`sn޹[taYEU:5kJl6=K4Nu"$.Ry#IҒ{n\ulJb|{‚6Zj%PwhɑUvϝ@вQ!D$V\=|@材r|֕k7`!6<kDj#_z5[":V=Qˊt}~իH\TD޺Hߊ)/]HO=}*>pd୛ֹ8-^hf:}x eԣ2f4n|qC;X$=,Zk`Ȯ1'Sϝϼ|5ƭ;?@bWV74<{9q+*MMWukoN'&;zh@^nN+Z[56Yg(1ϪAӣEAcUPV3y96vk7 hlɤ3i2/g_b#K+*k浵Du${C=QZS]]UUYQ^^-.WpV^KϥbD
+rsv?H$PکϔЃuWRӚKz2oGg7/_P$ǐ֧Sf\ȼ} }
+ ˰j~qqQaύwn˽彐q{2>(8lV >klL7ASuh)JbԸC=Zzhړfγspru^e[pخ}QGc'L<}&\ƅY._ɾzy7o1X[7n\vj˗.^8v{<hTA+/]l6ԟ|z8ŔĴSC'Dg?pnTT5 [.Zbs-CwyHt'O9v\ Xu R5sgRϜI9xD#"E=p޴VfϜ2NnĈa#k AGKo#%ed啐ғL9kE˖;:yx"w߁ȃ9{<.ĩĤ䤤S'D=r8u_o7'{,lFU":h
+Cw<=>U5W1r
+㔔UTT5'M44NQQA^Nvh)Q#C-'0i|AGHiJj\ս~L|R{{4},RɎP@ŲJKKIJJHB@ۯoJ_aA·4#55_l <xȐXt:UŲ2dAե%f FiJj5k,6잽zڻwo11~V}*U=;E矰R`P=(I]Dn$8'V]V26,.^,//-zhMrʼnHt:OD_oD] 0!$6QMD%o 0!_xA@TBڂ"DgTuj
+
+|iY/U-5E5%%m/h(j(i _[QYCYQ[SESOC_QSR2_Y֋{cQA2XK~- +4fv+ܖ9;k(ߠLl襢I+
+E^ѿ^cdX#Ҡ mӪ_f=m~@iDUqFwsyxKnK?]\Ez;7y< c\O׶t MkeoCa]UUHT+HhEMuZmT*Sk`љ.0$ Mt\f?w^V7"zh/W"W
+_{R7&+l4U{-=
+l
+
+ۯ
+
+
+
+
+
+
+
+
+
+
+
+
+T
+
+
+p*
+
+
+
+
+
+
+
+EBI H!["$ !"4HysYk} }ܻ%u~%S
+
+
+
+-}
+
+
+[B߅n3
+
+5t
+
+0t
+ihjM700d``?UOWGKSCMUe
+#?INVZJB\LDXHo,RҞ?C6T`ȃܤɊ*ȁ4#f3gYXζa`mm5bL3&F teɓdBJF!m`W01)B^AYE]S[Ox,ֶs~g8i"W77_WE ;mlYӍ 5U䑒 JٌVV1|(IB4m;:-\x+Wyy]ooU+=/[uB'G{6-gLJ&I"BX|b>~AJ*fff?R}`p7GDFEEoai!|}n. f3{R6EQ^NZ0r}B@HD\PОjhbD98-Z? ($4,|sԖ;w퉍 `¡C1 쏋ݳk-QBC}Wy/^왦zH 1!T"L!8m.,R!,".%;IQE]{6aVxist̎]{'$>t<3ig3MK=sd񤣇ݵ#&z kVXxf&I"B 6djBt 2asv)Τ8y1rvNn^ՂBWrs/g]<q6̩߷wa!kVy,uEEbmjDWSUI^Nj0)dUC=h,ߐe+-w8t$)tj Y^^|VYy*+n,~ ? SO''9t v׶舍}<ݑVfL< A- aD ^#G *Ե,m-pu_{xԶ]H's
+]QrNͽj7 1߫S]UYQ~ky9/O?s{wn s˂yFjR"ae1vx*s.^7 dS9~LzfVv^AQqɭj
+r]1zUϱ43F$/#!;*bq ԢPY%!#5P/h]8u܂ںOft_~w޿zݻo߼~
+iFb<n_S}F2RO&ݹushbg9B4U'JEȠrZ,&*hZ*â=p82q)'Z1qC/_
+ӧϟ|7W_|Ǐ !Mϟ"'߭]Vr0/9d$QaޞZ0UW,+ wհ6.pY(ΰ_T۰)zGɩ.^ɿvVEU  + ǟo@B Yyes3ޝbdBƙ#cwDo
+psi
+D|8a d] JNVќjlnmTK8v2ҊPE`o|%e|MB IN޾AJ?}~MUyKR% [q4] e Bȅ 9.V*ff_YVYL@EPq?k ^I!|W/>FFTݼw9ccGm Xby63Mj%*?`}q!,&9QQMgkB#bJʫ6<&Pk = >fR'߾*yOyT_{HQ~vfZ=1!뼖Οk9@[UANR!hݣHF6D?UTT{WϤ B/?HRH%H' UW !ϧ8WtX%NvVft'@g1PFȅrQ;%H=E&0Dm0"F>{F$ܬSIn_lomnK W]M
+DvS.f8zmTzVXSԟޢ@5Aw"~k%T#(G޿myلܭ*+.r!-Q뽗8P><ǀhWd{71R.l]=mٛpeUwqU|M  D=*WB5K.e:{KXLC`oWTg ؅ …oP䴋9J*<hxO (8%F0ii~~uٍ {c6tu$CANBD?F'("!w8%=+{=kYAUѮwo^5=i]r-bZrbpi:
+ =+fa=V`YUi(ťCkGM2&
+uԱPܫu=/+=p`mf"/-ǫܮ \#x %.-mhf&8b;rq; O[~٠{*Z Ez=jX>[h*Ob~XdaW Vԟa5oǚ ܣN.jj ˢU3Q Ok߸JYlg9}"]`hGMJQ]yO ި}DeAv` iU ^xX[CH Z4wdܮxF`/jR:F38-
+MDy]~=nQeѫ* |hPUm 'I
+ʃE* 4I)iZ;ݲPrkE1˂ 뗄'
+Y2o6nWhiNG?VQ
+dU]ԤyD>xlV~q9Q/ߐ.eAV>7,;ySqw;MWR<.v 0 m,q )b^1Xu? fbh.+<}$.&ljW֦dy? Qda̶w]qkܑS9Eehjn YÃ쌔C{C|=Y1 ̩.o~ DaqZ;!9#~ V>޽n~ZͫYi]z-oC8޾߭]jĨR*(1]W ۶XjV6~w]`}||z.jW[C<QyiO$)"0fTVl]JH\FACvφ='\/y}o?}Qm䃻6y/o=cdi1!dꣳ[/1QYe.KUz3/ ͻ_?xiý7/9JrݪoG.7zRH\w럾xWᙶ/>>OZ?)+r.9aWDMtUnWg+"2~װK*juCFu#Ԥ>}}ծ%WPylw;u)Ɩn"v%¸׀_h {|i J+;6[b7ka `FK {45 J&_\`JU7/>'*{ V:S&J{ ).=Dƕw럽|'Ҥ`7"jʮ]>?&tr'[өjhѧ6 "2,湮
+ܼ;ԅUQA5)/A+<]hFV,mL_ R2 1r\aKѴKj(FjR,ZǓեYg r4B!71LD[$ S[k7n;p"#711
+?0㏯hzp(lҾ!k[!<nȾHMV7h]N^/}{(1abV_7=zPy#\r0?z$,:(xV05muP#d"kaPw[]x*qWO!G+uPk!&id'd˾+qB 7F <0Vڥԣ{V͛e G+u0eVVIxos7*]t_(ԭZluJ:%4 f*kX/X#䅫wꞠ.~߭a_lfmehAdMљn.|W21fQ$n˧uwJ^8#o|+cm%uP2F0q ۅ+os$r Yjt)D³eYgw{,6YK*zsWD=v5o
+C6qSo^[8Wr7K1O/>~,62N cQcn^H>_ZS  /w`Ƿ^=DJSwH̫́5 [35XYY#^<b2ˈOp݆? |,G{;%yHGwH3F-}zf(3ewszwK\B2du@ʸev`SF+4:Q
+ޒ1rΌ9Vo=@h~q`V,Tv5PQZu ^1%鶋Vma1p'۶P:d鈍\dm(-OܜzB /*=yeP̫OF:6X`e 5~9e"ҊZ& WF;)vt_ނX<X:r3Vcl#ɒF AS#F/ilw|>4dՁ- % :a4{ؤshohz=ep?wY'2 g۱Bꆖ#+2> Ft<sȮ0%̧ᵃIN$8m
+?/|ܒ; >q%-qgo2hb}j4N37lב97럷 |P`êgmr3"hV3\DZItO+72gp`t.tƚ%`ŝSZ&VlK8}zçS*~ɃkSGx.=M}4X JtA&ӊ-'n" ֙w//+<y2Yr#dh@ n`|}Ծ |ǐ1hmP:Gwog۳i;3=܈Fh tmޤsW=zAGøMSCMI;C]qKFtBCQ{\Wml~ۿ _?}&aۆUFN` ckUBԝ7 {]Al+NovrGGаK+l;X t+4XfnoNFy~1
+ e=s{wq'G-`X;޽xt%akV#8UCS|R
+(4ք>c8E:fNZ2:&rSc'kٞSRC$8`ϹdU_:Ec jSѷp?u_82PICڊ 'b#ڙ*I1Cpcf/"FSf}d#Dtbk9YB*NU>[Mc[]l *踒b
+<%7h 3:^<[mJٸWqb«ɪ>s wɳB ۧ7MŗNZUz|^#O K)-%7ih򬶂Uh"wԍyo܅9?:?|\W@E8Iq0V 婳=&} l?965*0>[A3WZ.^ } V_?ދzOr
+q$*p#
+U9 [=g),#OgSO \<W09.mnݲ6.>a{g^]TPC 3Yd"+2nTw BF{_<^EcSPV`n+#xIF8Z5~a.Ll6rq<q"x w"|
+TP;WhI=%`<3sU[xԪ2::z≽a>ɉw8>jnBw'eN}XA~,졘@s]n4$tl9SJF8Awh#J _bc6Q;AZԦY/ {b] 򏯟Ֆ'n "C, E]sCgʨ-J;ŗR׸( 195 M*F-Bm88[Ѻ4%>{DO@9>#ն;Ѫ4\ׄǥ\*_⨸qx{7miNKyϱ^O*.J*5^ '!.FrAw2~;q_4kMP݆*7TqyBN<3WPBA~y` 5P
+*|Z汝!+#(;r 9}=opx}o[+>? "|<:kUNdłU_~{(A!Tw L&OB{8~g6A=>BlhZhߕ'p^ <w=P=C{0zqbx )QDmal EPԲ!6Q䷥뷠 x-<S!+(׸XȈt3 Eݙ~23C.1ˈ}z\ ǍJF7b?Cs4R9^ub-ǭlTbxXs8vd8'`2G+GGjTzвD֍G>4zuXPuAẒQ|
+~1Ш8r<H*?7|;8j78t uW:~ 9r
+OUМY1ߎR֟ԕRg`<{RU f*H(8ODVhb脳W+ꚠQqU36q2"-<Aͷ4My8YT&*X
+bӐ3.
+QTpq X1a;88F؀/(28~q6" q27v `" 6_{ƉMҜa؅w`<,q6tf.XJy>:3Þ8BJSg;D? T܁qTurލ!t;8eTٸ{cm8ymY>Ζ61qrv5|o+!˻W&DٴadSG[? ~8dG0 8O[TKgs Ĺ[' ]9\{2[ Ulڨi܁79oBbo3TQOʨYo.8bm}] UwH,pLĹqb,H?ʹ*cu<'-sa UOT⓵
+ݛF781N U^>o68S* =ޛι#hzrq-ꤊ5^fԼrO x~ivJU IUNК:o܁z8N
+'pa<mFEۜwP7w<݁/Nx% c<3Qc3Cps[/c*3O溡e"dK0Rq̣xS\A˳֍gnp rhaY8 <_wʭ%.Z˟"^MqY*q.\8JSoN>uwcM,܅u~T\j)Lo|XpmzXmR&5Unp 7<@>6~`!OXkOc,Y66dT#`0WZ?cc/A=/16F0lP{x>=puF6EYLimݲ.17aT5TfOAΘ Ⰺslq[=<4c*n<-HO>Rg<+e=cpL5bzbd#ψCCƹ-ڷ8¥\S䁺.~$ F6ur8P& ۵AP_.@?u.5JS- 6Щ؀U:n__+6d 85-:?5ޣ+6nSoхMp'N,<Ћt<ӫt<֫t6x“Ttх+zοb
+0+{.|2|~oѥއlKt;[w}5:/zN#|^K- ^/ѕew[t;w'-݉;w]]{.|W{FC?Ҍ[t0R'q. ObUpn S؆*m*8] s̡Jeb- *ᤊt/C~yR?Кt'R'UV?nr.^ָÊq.՟hM݌%F?(bt񧽳Ÿb!\b~i0/'b.ę1Np?`2bxzO3-ɶ6!ΌqML=AA~;mnn8qߎcs#iҴ1br3|%Qįp%ۋ ơ:"+q!88_lG(6V8iԡ:ǸDpXŠŽc<hL!*NA=JEmTl?Npٶ888~ sAllg}osPTI;7x` q;}!w!ZvcqN0= Č |֖9y_7 ]}G8XK{BW-@<.Ү "8
+J(Z͸n}S?=h<FA=82q9x Zg hM;f3MUvmqЌ;/*>5jU0Uq
+l|x8ĞNz4*FTԝ9ﻎ_~%=Z6nd$,DE
+:8Ƿ9Wx-w,nG1QG'|Wh smmWJmc'l\ ':ެhO,"x7Jgm p:0#&i].`*1Bf"M>*rWַ\qω׫_Mn?-hwdh Z3!7l݄ݼ|2.| oD;ًc"ﰽYw_di|Fqܑx۵Fmf<0&1=Pݛ٧ou5"TqC4kM)n<zIQJ hSӥժ
+:A_e?GXx1* .TBC.ڸ &́*g^C(]q@]Y&؎o3SGp%Ux! k85@E.8#~
+Zo^fϕF@vwπdqd;G` ^<ms@D_޽hq_9) Vqj"'.U7a"O66^i-SsJ1o!K5Ԯ,sZ9{N,]Cw *?<}PwPLn7KU
+ڦvKξYܮBFMUEObmkx@ ӪG2
+7U]Sh}^iNj–ef:[A^ .^uMdC2w03iw!q_[(Sg9zJ˽E9`nof:T[Aۥ8V@=3ANnǰExy~Ƒ!+,UdE]DqXa)Eyq7 6rX::ߠ[hO-vu;xʝ
+rj#^Tg8·zOYz<ϰئZd'g]G9ǖgH}
+UUm:zSOmX4mb{`lJh zUQU
+;?b
+}TBd3TSŽ*(&6A;84>~^܉>%-MqPK&Uޡfߺ%D0ƚWRb<TWV:cR
+10C 3bS=Z5t0{G@tKDt I+"7 |XX[QxDlR;3b}+_lsh%vW"4/1B_CK?JXJA{\5a٢t0 =dq":p;8[ oDh[6w0qO6^+ >=8yze3f2Փ'b7VOY8Xt^5(:6l;zƝ7h $vJ/Z=,:y *>GJysQtlu$=.x:HDW>mBc9p>cg>oI箖#}S2}|PSsPo9ӵp?9٧:a|}Ծd"a"d"hzt%=.3#Cn9k=:ԍVm?Utr bz| Dufq#4(P2]:d[™h'Gs r}ƩkSGx.=M}neq"J:s|Bw$]Q]sb,_=]t+5'K
+s%4t + F$߰]GܼSO h<}XU|̡!^.8Eq'4:Pt#\_cy5 h- F,-n\IK.Npa6 䆖{\-vmPd[_]͜Gv.g>UENLS F KN0ZD&v:d<s37p?wYh 88Jh@I+c+\(,xPNƱ- Չk Φ(GH+jOu^5k|7tQqlugiL$vp.KǿN.*3c 1O]*A322b7X`e 5SLp"Gs\W߷'&u`юNZhG2L`\9=sh <t2ҁw | %#.2`BkhS :
+M@kyKlܙЁ :gS H6&J2#<Nց\c,aHǥ'>BAK2H^4Ham[qk^2t0d|Fx;2xzQ񒔎;Ne%tأus >C{6u( 1n<Z Ppn\_;}߽zZWeĶ mkx r~S2?kyx˧N `EP75owK={]<k׏o_<6`L;7-˽Y)^ˉIw~WE2<mt*(*.)=Feb fnztrڑ=<MhѪYILRj:gʀȽ^~Z<X 4>o[vҙ] hOxD+os$rQZ<P1pʃڿݫg5
+.:3o|+cet 7EgǺ]QӀV1V>"Vg8XKvLD\VYzr '/\-ɋ7Q(KG*odؿ5g(2(ęlGwmroTxw0[1
+Oe<oWQ}X\tۼY
+}B"<cd5,lٗ}^sn՟}P˧u5
+޳9`oꓥDyG/RVE=z֝/lÜ* bzf~Ʉy:1*/97Om;1l$/Z.Z>|סy7QBuyARK8-tuU&J7::-_qہWlGVy? K]J;{lcme B|m>!o̻h-8Eqφ#g
+Jk7FY]ERDa4=zԅS7r5MMcG%{ tYs]+!|n1
+sFyvŖ0]8=ydbާdhҕVP70/4fR<pC. R!k[OS$)dKZ<h%"cR=2so@շ3U3Qq=\J®Un,pd&>%x,7^BNYeź\ Wh?~|F0Ҏ pkn(# hCLFA]}͆(<*֣g]} T㺚r\vGy/q*/%*VxJɫXڻ\i
+J4>tw}ALRDjwլTTWY. ~>,/<ANI|2<NϹ^^1jWx>ZjRjo]HNL_CR}22X0|h|uaKʿy^>iL80$E4G˜gi׻; ܝ]XZu 4Y.>{hRiwDz/Eaf>ޥP
+*5\+7n;r*3>V.޿~AUiavFʡ=!k=Y]٭0!vRR/ߩ} TrYcmuYQnR1aV-v65PCZ fu8Z=QznoH'f`o>B0Q j]LM:#"}YF(1Ũ]٭偆+SkG[JNtFECV}i/fB37'
+Y2oꊲPa]AW19iW@XLlbJkh/@Ew(/W/'ڻ%5)3C-IRlOd<p5AVQ]+e>d\>Pz%]!l*PpHHI ZꄛdqaDa.ŀUh?j"5A T(? *3-ȲmKFq}9Y&%'!"0?!,ڕǚ>; O[~ ]YI|EEVI Q?%;CXXԮTu8zG~~)~d;B( TYWuz^Ӆ6p5c'+5]#sGȏ뷪@onyn
+"-޼jzP[sZŴX|&w~Y$+QI9Ec-#619bε;?'BZ v,ߴ4@-FAvf1 Gs#]5& (t}LTT| 7W˪>l];*
+
+ԡ?ixPs(RƩc񻷄x\(I
+MF6MBb>a[v={fyO !e0T'?ķ/
+܍V\|xΨ]P]ϛ!c8!L@y{}hԎ}'R_/*_`!_2B(a9&4ѝ _Ql{r2N%ܻ-"5BLaIj
+rT]P.Db9Ums] G
+AR^u/w>RJH'H
+BjaaA Hij ߩ,y-rٓnfŒlfLT,򢵋%o}<9æ-ynU޹i~قJ,YPf IH !&T r/OK9#:,o2ǹt5e$.0}yWBF^Y]p%(!)i/\/)s1RU *- a? ߾r#M .'HŅy2$9#zSL}-Uʼn Lť&*hZqp^郄D=x$Lƅ%ek5<z 9y5| 1 _O/cuݩ&\<z2)QaޞZ0UWF-JLXʹ탼|¸@ԴfBâ9qrk%eUwb'&l5żRnǍ uީuzA^si'ݹushbg9Fz*,&wKF%
+DV^YM)/(t֝ǒO=rN~e5>DV=~yAb^x 9x#da{5Օe7PI\j]1aZ~T-5%,5h\`X>p %7YYbm57Enݹw‘i2s o*Ss䥮H߬Cܿ[sV⢂̌ScM!k<,gB_[MY^VJ\DpQD4.0a;iKy \z] )9x8r~¥으kE7JJoWܮbQYyViɍky9ٗ.OO;rhb=;nۀLpwurk5k4TʓpBi1r8[,.0C  
+QӚ:mLN.K=Vlu9v"ԙs.g_-((dQPp5?/7'rsigN8vPo{:_/OwׅY[j*cC β`*BT5u MgY͙7suA!#ؽ7C;|ԴsMK=}dcG:x n1["7^|aPOK}$YIq!R
+qII
+SԴ3-m~d*o_M[ص'6n J$Ao%??.vϮ۶FGFl
+
+^lBysfa*rbA}bp ^
+brS4uδc0=Wy MQQ[XDGEEFo~>^</]pt#]-҄ X^
+,X|/D$Q(#%FMgZXER]ܖ/\{ڵ~u]kJK\6V3MM 5TY&Ơnb h+d(\"ȈIIkL3nj>f\;{N -&Ao,r^4n+YӍhNQ<QVJB\;
+0P> C%2w 8!B4v;Ux 3YmXX[[Ͷen6cT]m- 5eɓdBdM$L,BxQ RҲ'MVPTM700da`?U9TWS0yDYi) bqcnjfaTtK*d,vDTL|DyEIIYy
+;JJȁD9Yi) b"B#1*:`R Q~le("!))%%%JRR;-c )Lt 3j4 /BamAA
+B Àz(ԓlB?` 
+yfZ5 K@CX<D0 !
+   g%t2!CZY!PfZ
+
+
+
+
+
+ 6l#06l(*A(Е:lHQG" P6z(Ç WK_
+|%F7_@P!<
+SԵt (z:ZSĄC_CGQP71b
+2|G e{a _<ce4[9:-rqus[<
+޺٬7JJKo 8JKKn\/:{|U UeExZ]aƉMT7uٸ3żUw U.IܹX}ظQZ_ ~I&s slvaIEU{0@н5U%g _x$1~?P#;0k}?k Θa7cfp:ˁ3>/ { {Ep½eyi(̗<jk]AAG
+]]ܵ'^3U5Uʚڊz׵qMeyiUmO3ݛ\k涹Ğ T?й.<1 t؅2#Xwy]MUuUMuylȘ`?bppT{`kŶ ;042u^x /M#׍78`<l3Z8u_6\?@gw3V]Ymf ?YUZ[m>5ƓcN< f ob}67ؽŵ#|s[()pחVV׻rUV*WUk'U#coVp\skpUTկ߾)DG䉈t/M! H +C}!R)`kf!R)`kf!R[C4[l l2D
+bkf!-hbkf!-hbkf!-hbkf!-hB7h)toB[C4[S[Ix [C$1]kX"$aq2l /aq| Ct <h+Eh}ab`GS.ÅithIhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖KԶhɱtOm鎖L춅PtOp[NPtOp[O3qEA43qBLAE|EGHEM5݁t`tGEt݅xf"t@DDD*t hYr!i*a,3,(:@4/_bE)>bg`PL#!(88$$$Afuy(G30"bexXHpuyGD'$BjdbDrY"yD'&2 ;JOMND&+yN@"2s JJK0?'3-9>:" Y@bӲ*kW^hW76Te%
+3RSE3}~E&dT|;<_zD~<G;/_]QM3F6- S/.%~c'ǯ=i"'z7֗d F?69MlQǨ=W_W3?Hȿ~g}uaFB1I3~V[?ϊ:FĦU~起gH~췿v^[Me8&%k>'~~eâsV5m7/"/|||֦U9abQ4l8q
+ JF"{g^$hw~,1D:2Dn9ߢ4HD֔M&{GX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDb"VLĊX1+&bDՔD~S"?xyH;'.D|N/rJψĚ ~9ϼ~?Hwt"F"{|o=o32/>|lH L*[ݱ{x/w7W^|eYNLtg?Ǿ×o{~W?{եL$Ḩ򍧞ѫ|w7}~ꏞ{_F#&YҰyȍw_ͷ7WOt#;77d&8.e!񮢺p>G/_篾O=ཷp"W|DH2%^Xgp==SO?^|G޼ ?|{΍)LvZ"+WƦW6o=}<ط~'<=;NlmO]Q,Y"(<&9qsy='2~?>x;?:~oscYNrLxЊeKH`XTbfQͺ{>C=Vك|+_;>zbk]MQfbTXִƶ~?=myi8KV$b6YEM{p㙳nŻϝ=s {67Ue4z֠kFFq+cGGGjk)I rԁ<$:1=q=w޳׻=wnٺy]cuI^zb1Et1$$IJ)*il^߶}KGt:on[XS^!1jIWTVYSиz^PWSYVfLGfb"̜¢Ҳ镖d%G#@Mw$1ɩ̬2]ɉ1ᡎ " B&Q1q G q1Q#(
+2G ݲZ NQK,mr7ȳ8Y'[DDD)***cg7%=$M)TS)ݔar2MY'?}pg] <l6vR^ߏ6>|OD A!>&s=wA!@D8"(3R\t'H<Y6y<r@t}ggTTR̺w>Q:wDDDDT/(((,,,***...)))---+++//khhh4Yeݺu6lhmmm3m=Ww1camfvӳ||]a"=L_#
+ۆ-tdw{W.!+$1I"O<
+^#g!3E7q4qp_Ttt\%|1w"1[} zbZwtttvvvuuuwwl۶oǎvk<p:4<<<?>?:Fx <.mÖc
+s^juw.Ӟ LϊY-8{Cq\NsXY^?Ŏx6nƫa\ `gUxDFkVDbǽ<uW¼,撘EGo79 f2&vGxcX9AQ"754qF0ymԕ"2,[v;LTKA2k%j}i/ﶈ(^dV,YRO/^eݹ.>xAě)Xmbq(.X$ \q%٢8UB?dagEw;E O+Q3O81N*
+
+*MXX{"<'Nκ_"kgDgɬlq1AGKX~vq'$EEEΖ?͊-*&&jHt8//c'YY>V|Y,kC<z~7ysEg㳲rrrp̵1lyvVK--sVV Y|=AhpeҥǫX;+i!oxo/ ZDYܟ;«j+^aX>ii'Isݯ⣉ZhD>~[V\Isݯb@/
+Dd
+ϏZ:뵭_=X>Q?C틇|JwDκ?/:ӵU%\h,>oyha-S;ybbq*l7|
+ԏhYRY/3Swg"thwEvKs{N}\a-uGtv߭o/dgNY%4n߄3ok YY"5^;+~Ev[5Y WkP,Ig(7LJ~˜yvנL-/5mwb(qJYϋba<opb -,l;5-7[ ߫,.COD
+문hinp4nߎ>o yᔖ%R浳q
+EZ`Aܝ 0oΊ7z297J\
+ agxqttX=A3~oP2x%R lLL=03~׌xA0 c ZvV9+. T|3~WwʳDʼvV#.@%N~3ʛAܝ `gfkΊ7zⰦE$m_-nHA0 .>V͖Ί7zPxiW6OV↤Ke([,lI:r%$$`MI
+↤CP_͖8Ś7M˛A08٘%R0@wqB~~!i.PxvHto$%%aMI
+↤CP,o\XӊPXX(nHA0 %ޢ]b;K4[΢\;8I[Hܐ4`(q***%R㵳 QTi8I[Xܐ4`(q*::)YF
+↤CP ]D
+v6""B233E$m
+qC\ ex<;K`jgQ%Fʕ5-'i+TVVb %.C%$$!Y"uBE$m*qC\ eDvH(%.`MI
+↤CP͖Ί7gQ\i8I[Vܐ4`(q*)) )٘
+Ú Is1,:Z\XӢqBCC!i.P2TJJJll,;K`jgQ%
+B
+
+
+E$mFqC\ eT<DPP;K4[uB
+ E$m$i.P2TZZ;Kf΢V(WQQִhk֬CPqqqtALY
+*..ƚ Is1222Y"5S;*PURR5-'i+477b %.C\`vh,jrbMI
+---↤CP,KgQ"tBP2iݯ^
+֭7$ J\JHH agfk΢V(Wyy9ִ†  ys1 Y,YQ(
+媨 cI[Uܐ4`(q*'''11|͖0:Z\XӢqB[[!i.P2Tnn.;KfjgQ%
+BċyfqC\ e<<Dhh(;K4[uBQ44NVOb %.C糳Dj,EDgQ+kZ4NA0 UPP)UWW5-'i+tttb %.CDjvUBP+kZ4NV7$ J\***JNN |͖0:Z\8Ś Is1Y"5^;BV1ִWXmnqC\ epvh$E֬Y5#nțe(vHKP(
+jjj cI[a۶m↤CP,IgQfi8I[Wܐ4`(q%R6
+Z\---EVV7$ J\*++KKK[r,uAH:+.@hhcqC\ e(vH΢Pʵai8I[a׮]↤CP颳MwD(Wkk+ִh/nHA0 )tV|,
+Z\mmmXӢq!i.P2TEEEFFԯ" ,ʅ3Pi8I[a޽↤CP,2¢>(j%.cMII\ eJ5,uAH:rcM:888cs1Y"e΢DXPс5-'i+8p@ܐ4`(q*33%R ,ى5-'i+<xPܐ4`(q%R6
+Z\]]]XӢq¡C Is1~ջ0yguzm+ b %.CDʼvBPimqC\ 1lmmmvvvtt4:kuA;m60FGG Is1€,\X:aɊBV(Woo/ִhpqC\ 0`{{{]]]NNNLL,uA;'^d%m1qC\ 0 ;K4E}Y,YQ(
+ڱcI
+↤CaXvhݵkִhpqqC\ 0 ;K4΢DXPߏ5-'i+8qBܐ4`( ؘ{Zra- `MI
+'O7$ 
+Ds1
+Z\8ŚN:%nHA0qqq"0cgE$mӧOb ͑ggQ,VY
+BE$mnIܐ4`( ݽf͚xvhf,ִhpqC\ Y9t%’BP`MI
+gϞ7$ 
+455&$$._tAYi8I[ܹs↤CDs4XPuAi8I[[n7$ 
+n۶(11%;5-'i+z↤CDsY%’BPCaMI
+v!i.P_nbMI
+' Is1bg]XGtUBP+kxxkZ4NV뮻 Is1€}}}֭+))IJJ
+a-t>Obvh,bEP+kddhO}Jܐ4`( cǎ 6&''DKg8I[3!i.agγJ%+
+Z\7t'i+|7$ 
+ڵ,%%eʕ; E΢q Is1;K4wS;%+
+Z\G9s 'i+{↤CaTvh|쬤↤,_xvAdEP+kllٳxՓCa͛7WTTfg|cgmfl.;K΢8XP5>>~9l%m/↤Ca{b@?{"{gk+河D~d,XPu[ngxqksEm1€*##Y
+a-Զƒ>(nXggQKV
+BN8q뭷~3,}Mܰ4׳CajNm~Xp7%(,(jr<yn??#<"n;CatvvfffFGG; E`.m7DmY"?P΢>XbɊBV(שS>O?~Ӆ$ 
+<x.+++&&&88%_:㏳DY,VdEP+wu׽+/췾kA0<tPwwwCCCvvvlllHH;K;-.<%Z\xݘhqD ?ED ]?KX:SAY>(YEE--|>vC@L,h!YówϗΞ;wVbvh, Eg[ZZz{{O:u[LJ*
+A0ġ
+A0;K4GS;WPPf͚aM{$iCa@
+p@apvhf#G=i4WVQX Y9t6888666??kpppttk&Is%m 
+P X,/fִMJ*
+A0;K4G]tiPP:vvvݻwxxkqb q(8,`֌=tִc&Is%m %mhh8x ִGLJ*
+A0ġ
+p@a!Y"_;cbM;l4WVQX 0 ;K4]d :][[y澾> kC&Is%m 
+P XD%loo
+A0dgـȬjtv۶m$͕U`( aq@ap"YYwg׮]۠I\I[EaCa@vh.v633{ǎXӊI+o+` YpX"uvvuu屛J*
+A0dgbjg#""\.Weeekkkgggoo/ִ&Is%m 
+P 88YYtvÆ ۶mÚ$iCa@
+Y"eήXbʕ֭koovI\I[Ea1€8;K@ٖ{vwwcM$otm ,K.$:^^^܌uuuaMg4WVQX ".@P YYtk^bq
+vH˗/OKK+++[fMkkkGGִLJ*
+A(
+p@a/`g|!lcc ۱1I+i(,p(`gyljjjii):n:bMm4WVQX ".@aXpX|ta-644KXv$͕U P,\LlXXXJJJIII]]]sss[[ִ&Is%m 8 ఀ%IgkkkZ[[K-H+i(,p(`gY:lٲ5klذuk7I+i(, P8;K@٪*q
+kZQ:Ism ".@P)٤JTE,ݼ6WVQX ".@P YY XӶ$͕U P8ِĂ򺺺&i[MJ*
+A(
+p@a_Hb痕֮Yk &Is%m 8 Dj,]tl^^^iiiuu5@]g7wbq
+,:[RR".cMb4WVQX ".@P;Kfjgrrr+++m6I+i(,p(|%;K:]TTTQQQWW'^jA\I[Ea1
+
+*,,,//E֘$͕U(
+p@a,/lfffAAAYYYuu5ִt
+D\¡
+A(
+p@`gLl@@@LLLrrrfff~~~II ִ&Is%m 8 /dg|1]g\.W^^^qq1ִ&Is%m 8 !Y"^;[TT5mI\I[Ea1
+A(
+٩_dbǧfeecM[b4WVQX ".@P;KfjgWX5mI\I[Ea1
+vV|x6---++ k|bq
+ |%;K JHHHMMĚ6$iD\Bgq@CD
+v644Tݓr5I+i(,p()t6...999##kbq
+ ِq8==klbq
+ta-vuV#.CaMe4WVQX ".@aXY"5S;lٲ`tVݓ5mI\I[Ea1
+v6((Hݓ5$iD\¡
+$ONNƚ6$iD\¡
+xG\š6$iDbX/bg|ᵳxEÚ6$iY `gLҥKQ(vOLLLBBִ)&Is%m ,2ygK-H+i(,0,CXD%ήX"88X\:CݒLJ*
+ ,%R0K,A=2ִt
+DbXY"5^;|rtV݃屛J*
+AܝoZ~ ;K:+6$iD\¡%R&טּ %^jA\I[Ea1
+A,,;K:yu2I+i(,;K^;~G\šVN\I[ag|!ұxu\I[Ea1;K4wu}8,, u0I+i(,/@DKYq2;ݛ,/$u_:vwV\I[EaY"K&7WV dz@;K IgݗKJ*
+AܝF;K yge(-$i
+YY"_;+.CaM+J'oAY"etVԺym%;IgݗP`º,\LK<.+ixu_bgͪJ*
+QwDSZQ+i(8egbV4WVQXwg[Dby,H+o
+MD@1 a!b2;d{/G_t? t=
+]DtODSAݓ}alBL_pt?!tQ="Ʉ1_zgp[Bv5 hRVZy hËf7e/Fڟ-@~k/Rڟ#-@k.R iҵ /fҸz'"Ҹz'b/@sw/F һ 4wzb@/Asq/R һ4G'"@/Asq/R һ4G'"@/1?f@21>ab<_6c~8xOq:ytm<X8ݼPZ oиv?]3a2k7chSo"'EͰl}#kyx9N9=Ymck#?>/sy 77]#ٟef=ncn`ϔAycsgv?4ر?'' """"""""""""""""""""""""""""""""" """""5K/&ݦfjbRep{.1JYi$6RCх{懱'FF+"hR``
+
+ dDl;8c 18 'Ǝc Q+BU5B7W \=  OHH4$%%%''$''%DEz#< 8
+>3!!)k6nwpѱ'NpԩN~cGG|m]injQ˒\c+VXNJdJǓս$q& 8 1
++״u[j=k'NVUTVVRb"&gR3r
+ ?˃ڗShdBz^imƎ+w :|MPwyǭgo:yоunTnq5g)怱عb Rc#=ZjJT4~/9M5N.[f͚ƆD#(\Мu#dMĹl빵x#̬lX۶W=8r솏Wv빏9g畝mk+.J shc*jp>XW[U]KO2fcuaCǶW@.I,âR2K*״lҦ6֖_h,3cqfWqnl5O=Sst'X?IrV_ּasgO#Μsۻ[*s҉[cK*pNزn= ի.Hpo326%n]{O߮]}WXsgbɾz][˱"5 QfK/jhZ׊8Z77Vl<K*(_ށ?|cȩnݴnM]eI+8]a|Ml4ҭBڷtlm}vH}f]\vs;zzW:穬wUܺqfg&<:1=q]ۖ+z޺e389l|&gϫ[:tӇ?2s˪WMn1K'Źse-mWnƵ E٩񑓧oe ꦶumKN\i68p`po-xsx҉3ŬK+/[ybW]s{Ԯ*Sj=ewNf2s WU74u:kغWī8-,ohٴ8s
+H40D\7A83k6v^KNtiSqڴC><2<4{SSMq1qębniff0 sZrןxT6\~Б'NLi%5jc ɗE񂗐QXgvSvrDNKr:i,sG;6vջϕx3(ÃC 0q*%i-'.-)%=+g];GƎ܉eeQ˸\2qqzr9]CCۍӒK\9m^[[
+2&%eK8ĉ׏U榪K͵{y~sU׌><<`"'r8|%>)53e};vо[ZJ\I;SFNc߱*Ñ##mY7q]!`z/o+IA.5VħWn*u#wniOUT#0k%y>K$]Tt=׌^gMUEYFܧ18VAe
+$C>go-庾&}x׿Gi,G}Ufs+ҹMSN?<m3
+Q ϾO?of`F_<z̭ۖ\zկ̦)'/Mg>Φt4M.O|
+34%*&ԧADw?MI dr!dw?g~K9]z ӊϮ'*z ?+=4_?| |9ͬO螘=*Q9I:>3}=^ʀ]"vPN3:2"^agf1y"{} vSǒskwy?w=iܟʩ V {x%/ӈ=6]?`>vB)5^\N~H{O}믟??3llXWNHp۲`eO,Ԇ&Vw2ws9v)+'[AS޽wk]֠PNν?_ 3ٴIeqλ}zW|h4v+.yJspE>oLN.o߹kjokuAt5%o׭2_tV L~sO˽;>4S&m2_,mn/brҥKb}>tauc{woow{cu!7{k^]O}fW6w_t=4?<|wom.yYՍZ̧Dt޺}޽{wo\[MF7QWc|09ZSgWVQ2mZ췼~KGptzfaiټPb~J} ؕ-vzݳ+*WWz&G`e}skksc}ueyia.NL ُM+n]t&ˤW_֯NSٙٹlʾL`Wx*IOOPixAyQa. wh|j:;;7?77˚ex*Tb^vd"ZUkqڻn%J2E{k:W~/F'e}),jȻMط;)oxo,rv Gx|*:91>6:<4lk7n6tt#vy֎E#cv@_W,]/^fWeS1ɭo2oo`(2<22~|1Tڏ#?pļ|_L"H.^=j ۍ0auoߓ{L[U흲Э%w8U-:7L=u*ힵV{C_$+/[ZeGy)YXS_vеDS޼4ծM UWٟ.bmiY4ygDџn3/ [#,.]_\?œ֚xvQt]k{[d㥢;j;h_]@_goܹhzay>v+/p{/哙_ڐmmc^P]Sᶝ_;#-w9ʕ_p^;vҗf3~ LE;~eX?~:Y%oi+q֫[._zů.v)P~}~ԯN
+
+pʼD~u|Q(Եp6%fBwnj_
+\L5.:@vUFix@#?@iW_\d ..30UIs vMEʝvEEeJjh؁])Qq?@yѮDڟz\hET.>P+"*g( M(ӮE}Z~@v(7R<PVEF}΁]. [aO]1<B0΀v%]I;ho@NI؀ѮmK;2E\ODѮjH;&˾@$ѮjE;eX
+
+[..Ӻިml  u7ׇnJ`]YS[oTN^KJ?1iTזށ`_WkcJIu6y
+hE9$ ߬mlN v4K+zÆD[P$jk
+K\UGr!WY%7teLk싌Gxl|82^MX:$CãcjR?Wx^?${ZFT:D|SVΞ>ձhl*>i
+K".B5uOݰ4QTy%7"CԪPc{x<eS^9fN%STrjUkaK hZ5QWY%sGWym&spi`CաƖ d,12ӱAZyS
+1"1ųV&0zQ 5t*=30?;M\754wGLL͘;[k6tKYzoFN㻀644655qhWW5xfnqia6=5P,g:-,-//-̤\{5<=G^\S7MXήR2=4̙-eL\ZjM_g`x<HegWVVsMܽ? ڑu{MPML]<M
+21d *J7n 5D&gWm\[M5oj
+^rvvaie}csscm1%τy'wW2+jLut) NLFc1;Xg:OU7CmhjviTL|LZ_/D흝᮶f>ZU jQs(RЩDR+ɩ!NMWo8[^5qZF&&+k[;{{;[[!&~-NꞼԘ6Q馈F'&&'2 Mgٙl:3 &*5uMᑩڊkw[=ۻ{o
+
+tun n7fL'괊HS2UT!'EtF*KKK34VS5q]1q]qmoinn-Jepppkw˴Dtlx0mm2fWDJOiUMlԮ~7ALٜ",;`1ѴzƳ .VS륺f%{ dlbl$2809OtތE" 6{^d2Wra*t}}ccskkksDD@(C}]-5;-;wn\[^ɦS56:23ٛCdBUn]]b4VVȈq.iƜ++qֶlo-LGm"mh*5g6^Kk[LT޽+qX]^3 tj:&tDt\h/_&'%+WZ}~*QY?îo(nʹake4y)Ѹ78fU/.ۛ+K 3l6N%㱉QYM v޹Y[QT婨]:(Ӯn%RUGSY6 {ζ03lXwl\ӱсB\Ҧ"JQ)N,/a'qX$,ѝ".}zKd kxQ^SjƧ $S6s`'&[6& K8zkgxtӱ@|MLgַ|G⻶8?k"7X?v\+d޴|[% #cccBcIR\_GiBzK~c\Lff`dt r%wWowT{kɩhdOƵ&rTV-Wj]0:n'X7.!M3f:;oI4luIVU3Y^˥#2TW[[386҉{Ch ^/jd}#ӑZ7D~1QMڨkR䘴I 2d!73#Cՙbo{xږj;=?Oڐy֮D*ͦ&<x455_f޳/ ]0W75.s&AIhLd;Z3K^*UMU5%n'd 7'u&O 8?7#1ly b7wQͤxtbԌJMz2>usÒx%2p2l[ܑ&w_:+K g%Ilm]TcUVL&dttdZP~e`#;ok6۶K@$ۑXYQ]]#oh̀t|T!T$e0WV7ib\Tw9hީ?g+ -ISUMa{SΪbkL/,zpJ4\̥Sv.ah@K.Pka atvfn,+Y[.ˀxomQ oS2`FN
+Y&9K1iR S4@s[]=dkȀxt\S 󉙱%΍l>?fГ^kYfDu/423I5yNQi*/#b͚_ڮt2<lF#v]R#kfYI32'ylr=4VwSm;fZtO 35xtl(dU)4tۻC_#ϸD!cpݲ};G`DIO"@(:91>& 2{\wZedG{{Lutʄ&Uv<eӒW쓡e&S/OʥѱH7=^q4ҴڰFUL2i* h|*F'''L(ݴȰ{bc&e{g: ( e)T۰[E#cv݅fiSX$L\_Q<MMJTIofV\eu"-bR?v{r~-]>B*UԺ婲ظU_+e]_ZI2?m\Ѫd̴8uŨaOalSe4i[o`ߋS'=/4AVYt?F"=-׮j4 vMDe465.t]uY- MDԸu-7MgeRUV[[mjzn\j+1֨{[Cx>#-!5S+isen1nL3eS8UVym캖hB}&Ӳ2+snVp֍Kpo7d\ًcSk_Y7y"\Ye.ͮd{h7b-K{jۘʺB3n5L՟wI|/޼Y®foICa 3l%ށ0v~z7֡pO#4Lʬផst*]7W
+G&K?_u~%4nNӱ͔1*d[Z{ݠhgzDYM)LyffP'Y:BX+^e;o,YUUۖM~a7Cdŷ'~eWJGV͙U;Ú͸ldg5JySCbGG[}z&I0oo-,踺!]r&Ǵq'P$఩Gw滻ݻ,
+F?!Oކi/]];d{{UIBiI<Uu@ZUB-so,s)T揚揶Mv k>QYUYa]][t.LFx- m('}9efcaGcVrXrzg%I].>Z2s|y{ߗ
+um
+_ozk6M]u]UIN}N.vhKYֶ8UVD˗f٦]Yb---y+Dox;ʏ*8DY!|IZv̜-0a-v)
+'/Vpum1m ,edݳ8q\Gas<Ɵbae (meUvolxSvRb:cFHYwɵߒKGr^XIm?6G)PXVzUuXǥ鏗|mŦs JMvG]/ "2XpEUŌe=iauti:-M [e{KC&HaleI uppG[_[kbU@_3tD U#dnqm{쿳-a= 9P-/iITѰ3[{޿mIšJTe:{ITN~?<O.o{ٗtB؄lf\f][w?xt]Lz M\{$ϱspwy{I5'd7q-c
+*щi9j;Xy!vG۸r57ka;w T|ҞtNꓵr]
+[=#JMgDU^,s{<_Z-r>݋.T}Poh rwIN~xckW82KQٌGU;ǞAX㒫lwd<*&$QNTX
+nMyuru!F '94:>11>j3pNKۏ]O}rue"Qݝiq+ުvq2Emv=x^c{]1,){{ީmVka :yFy[#.I!Ɇw:1GaS+MƦƆz uo8)5M&6OzXMG ջ;6]]~d5bN,twU֨F,¡/)a7᮶Kx 
+TW1{\mt^O{}M /|w{wĘ_Y^g0YC;mhvǣSgր8:k('zN[N 2 5 P($gD*kcrCibC饚:3B)6yy"ͺ]m 
+P\n-1LME81JM]5in̳Pn-.F9iq/P|kwo`ppphxt"sh66tl,!  X{ƒ<h<|쑖C{wȟoƦ≤2-o[kKsk#D^u:N>%
+Aua]MƼsT@?4cؔuǝm O )@u꺳Krm:=N\ Yf͞ oq)5 Iw /4-Bt[ .{nnI\-`f80$mܒy;`zã=mMi]8v9=U7ؕ_q"Zl`R3 J\nnzZ‚9}x>۶^on_
+WHJNx7\ݽd #9؅m$~`$q /rYm}s/k![˳^\_e GPA&wӠ г H\6amli봻bDo} 3gr [#mPn0E/epTqN`VmuauwHNL`FuzS] DܩU5 Mj67*Wyǘ堭r9h_`(226KE[$Y<(nǫ'.`pp(2<*ffgsdT.`z\7u E"ɩt:ͤYݦ5|G1{t*JNM 䟾@5aiWǍ1蔉t2.v[ D
+\h,b6)X$]HSy`x<:H&D<H$NS!ACgE&LdF&J\&7+<<1F63Uu%
+GhTp8jZSu*i88#;㜱1TSE:;֖붺׀ofnǯ}ݝ&MFcccC}]m a 9]ckGw_Tζ&fmmȨYu$oȯi5==օL4oVY7n\vkUM]Csk͍u7_1ArY0a EH M--TsSeԷkx:TW $o0Q]"AϹY5 k fě{fV|-Bp!&~* k׮_wCf .K$ZoHCX/ [B˘aLsQU
+ert211΄d,H$d.Kf҉p&;K[X25 ? eӱ\<12Xm:g;Tl&JҙX2J6ϥ͟ųt<'ۘO/K$bd&ƒ霼ݙy ;sX&1-7zfZQ T81NSk_?g?W|g5ct. zP#)gO^>?<cL&1&x!0w_c1GsB6OCE% <xG^{SM#roSG:6{hG=☐By#clc/+;^~vO <G+;3n>;oݧ ?7 Ͽ~NOg;I2TX6mkxBx<k~{?~sfٗ?{ei4߿Z?ٓ{[013Jc'cű_ o.<m&_23_D;<8fM;7
+
+
+v
+
+K!QWeR3x+E%XUui"^{,(Bjyx]!ދ
+!ڇ*B=K !NڙB+vi%B 9^BH}o#nx]:!uNTrAy+ՑCx]!o^<R@yץ6#tx[N!
+}ۅ׹M!)!^g)!e]ufB׬IB}g=uBHx>ksBNNV:!+1.ByxVk
+יC!g׎ !ׇ3NxBy#>NiBy79^'0!xBjKuRBH}ww!]>}>!Y?B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!BHMh׎sX:$(_6T?…
+xYtEB ֶ6YbE3ͭN^V~Aro=]*zG9
+?8<
+Tz%)8 0F{;}pU%KŦщ陙)c|txP;V
+R._Nv~
+1f D:eӺ8!F:8KP
+5
+ñ
+(/5
+@nie }"qz:"wpLm +BD4u5Ϛ Զ@|z4D- ƓL&../`,L#P
+16&Ru8Z6[vV4X{ۀhdR*OM:B hñd6$cjA8& WW{ë6Bm
+SBU @M 䊰X}'j2ڊfvrl@`ޫ7IdV7677֖sX{;:
+HRp@}RT=2+뛗/_ސ~(P}R=4>Ng,fS¶ ͬ
+.}s;
+CH<_Y/ZBijZœ .,,Db̢ސl?Pi&RͭM9x8 Yp4A8Jer7vd4T\
+Y
+Z7
+@VP_Q{fv
+@5C?rd5>vU.e сb]
+K wv]z`2/3Ila
+/? J]=}}ݝm-h Bc3
+ֱhOѭ2ydl|bbBmԯ]ؠGf
+^X۾׻ oQ#'&d׿
+$/35[+`z!z:}Ni&E*i#eggGU[A0o`d\;X"-.k[Mg"{(|u啵uWvͿ/ 8_49
+T
+?9)_[ȼ8'I#G?-=tގ.cIfW}ݫepגo)VEDickT8潰ɃZ٧& ퟁ*
+VϤL5k_Zxk88X8BR wCqW.OTk}ãzpN?\ڔ
+O1’ B ]^O-)r0Pޡ4>*q!Ɣ:ԁ[/[z/:3 EW%V)3r+Y;RI֫e:g|W\}WE
+ "5kY7Яi*j-@:diG~kZ (#o9Q!=)~ 2g hOZj@:pcǫ֋5ظ
+jrO$t6~թ =z/c?mYM-ziZ5335iEgݙq}"mG&' ?#DR-Qk>d
+YͤQ@q@s7Q|Uwx?CX$F6+"~en-WN^#j=g^ᗌQOM[ZZq*
+
+@<:朞P4tu^{G5g
+
+=(~/gxP
++`r"
+_X@_%}$uClSLHOp
+lpEj7WLdl-{AZwWm[PǾ
+>=P
+
+T U
+& @S[WTpAMͪ~=ύ 5-<eyhg
+pH32 <rݭזu9#;z&f1 7s k_9_ ]O#`}U㫕jqi[[iM7Ⲁ,. P?oC !}\pVUlLUznOg>[.SX38jL32[kT9A5C/L@}/3u[{r1Xܶ_gZw:[MTK<'IC@kodHE݅*7@œ;{j~8xH-C|ɏZA.
+U~1޾Zptڼ]m3w-QuE]7)Pϳ zC; [YC{:-ʪ|~P"MRMVLo[m |qm
+ZU>3(nVzqͥZ7;^`,U~R϶1҆Q`;ėU~cj֝%*(\۹r{UQ̩7 _Tx aB!B!B!B!B!B!B!B!B!f\}7ߺՋ뾯}]ӼFg<˜dOwſGן>ZsϦ;_ƌGbLXHLƍ2x$ϘB"ɔ_sTLT֌rnH6}t6ʦsƂ:(ID2ɚ>lHĒ0t$x:I&30Oa.1D$=L3/ͤd"xL6ƿT2 '$r2tFO*c,rd,5*GaߢǏ<|ދGHU~񽧏}E/gCGw}ڮ{*y/?RLT^<W[_>M"y.U&KyߋmK帼~߫˸]}>i^y߫:{*9*я9ީbrb.{ _5ֿ~!}K_|ۻWϿw{򡯤4d1a#35nqqcU\0c{Ə&f<nᏇ>3G2r/C§
+f# ӴŽ\ɛ>tO}ߡib,Z,}wz:̡O&c#Jm[z˒ү9~_2#D*.i.F6@ ̤rFC+=xxтwOJoqȋʋl|r}|YÃ8wi3TY( ?7ٍ PM,bfi)HӴ&n#L*)Y;|/I't(U  ƐG83{T\2wx8 ge7hgj]%KK?课_1i{ҠS%92s ppT*wz'(:X>߷, ^ۏrcB$+o߿ueG&
+
+U/hm-!B!B!B!B!uB!r'E 4HoAB!B ySČHΌ'3I#d3x
+i3Mdp$ә{A`TF$siv@X1 }>n'"鄙uE̜,ޏGbd!3l$JR;>uxwQyfH2t<Wsg3I]Lc-_,ͥ*^T.eE.䲸2dG*.`Ʋ[Ì?
+d:R
+[!3CJ>4Kg&JOC?a[d%T(hYDT+l,ͤfKj{Ɋ7tJ!BBes*9ɭ/^S=gJyX;P^lIuUf\*L%sKX?v3*$7RIC\^ٜOL%bD,ݺKH*I?!+Q4VSNu)44lT:'Qپx ^\X֎DC1T(R}B*H+)q3`+CaH&tfV=PzM㟿WIt/bƋxgE(lwQ#ݳJa%oڟ}ybzѪUaJ{HMerZYk??T2kd$i­n.(ݹ $ef.~f}2>lx)uo{NJ7KxR*1*Kjy,%l:Q }2%d w6%j'AJ_m\)lJ7K_\JUOt􊯷j+%+ T9{uT~\.Yx D +DgxTZ7eH*nt=a)D>ʔ_jY+*~zԺR&ZR="V۷oY+Z̴P% |<KIbfJD<2bݤ f3YU۪*xό&2s+"lnͺe}-nU4g5\šyk{x~O~Gb_|߷UD6b<?xa͐ ύx2; lo*߅< doAG6Wwh6d.)3Iգ 2 $#TPR"TfH<L$%y-JTƩ#Ocif
+nDEI$ 3fd3G}Yos O~'B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!zBtVxVYu444x
+J:+N:AsNs^sQӨijj )˃^~=൒
+ӵ8V}EӦitiz5r!7ayPPŧk%^Qd(U֌i&5~MHr!7ayPZ~El^+:]E"FP'KKKKkkkjnjh>|y\M|X؁59E"^-J:+NWxU1 gϞ}w7OO_׿5>'y<%f)*ZIg1PNW.\jRxt}plu-P\T$k%^+-G൒
+ӵ9k%^kR\*ZIgJȫk%B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!Bycz녩V Lj`USjTZ50ժV Lj`USjRB!B!B!B!B!߿u|뻩=ֽ^?]}Eן_{ǭ/>7c~Ȉ~デFp}_qkxv ӈ}O/mCGwf<$DXHH6e)ӌ$Siv_^w_|QKws{7>j7nO>{nfT223Ft|`A5ʖ3޳_?||ӯ5:_wpO= -[?ݿزULB'V*st@6rc/W(/|/zyo]0>O$#D.m,H<Kc$kdJec?@Y#>я&?|7S?.o$X:hB!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!R Rxt%Z[gJYᵶ
+ӕkm^+!g:+NWB
+uVx^k:]듆WCYuzܥq5օ [L9Ay… \ɿ{x,*v.h<%M65-6Zmi|ǁx]xK) wYOO߂koo.,\^ž8'DgO<:+"Z&25Y
+ ҋNMWWWGkOӯ  kF41͸fBch&5SE_O >gax=6~HxOm-%bH%$ ~;^ ?zJX?A~ "# %& hORIdIpI|{vHIf$va9 QCC8NVH*<Ԡ>%7QK%5@  CP8_XXD"h4x<H$d*d2l6/iVVVVWW666677w4W?3$0.
+)HC$_ůF:#v?yAsx,-KfCH)0H@K}oz7nܼy֭[o߾sݻw?O>O?>?|ѣGO<y ?3<5{x%)$tS.I[<Ri$gxg/&~)Z~>i>0C )iM$mZ[gK=[VM k(]R+O|߈od8>Iڏv"[CVy+?G~Qj8U^kpl kkϊ_sVI_p(Y^Xƿwloر=?ׄd/+뤆+BRCxs斬%=g_'+U$-p2 ƁxQ$pZUr>[dq6pv4Ť9#guVduPP!RnU{;"OYj!XžZ[gZ{Ɓd0&C)k +W!R_G(ؗkm^kMYI;{U3
+SfepV:2d=:2CR5+=e(rb\X& PTfe*CXEr\8)`MZ:!Zj*Y聾2rjZzpRX&mww75Kip,!EEVI t˦,!UPQДtCeZ4\X醒j8Y:DCEVI
+\8)`MZ:nmmf  *CX+'9B!pR.,ً/RTf/9ZA8 'I;00FR5 MvPZT.jr\X4i@jꨨY((]
+I
+\8)`Mڱjq,}AekQQ$IpR.,uERe&hJ:2(]
+R\8)`Mډ t5KHTԬ B_PZT.jLF. &aCCC===,!QQ}AekQQdYpR.,2CRN/ a-*J|>/NʅAvjjjdd%jjj, *CXE`iiI. &h___SS5KH8iʂ2(]jI
+eA_P.jr\ Ѥ͖uJR8iʂ2(]
+vvvI
+eA_PZT.j7nܐ '‚ljD"uJR8iʂ2(]
+n޼)Nʅ؁d29??OR55ʒNcV [Q֭[r\X4iSf B_PZw۷o˅raML&DYBLr(bWԆT&Z;wIIf5KHuh֢tQ+{\8)`M|>OrjjBʤuQ+IRբIieYz.(h Z'|"NʅiRE֢tQ+OI
+>spR.,mllP` ,bWDiZ8)`Md2999yZSETZݕ &5Ki(,t+"X *CXEÇr\X4iS5KHuh֢tQ+x\8)`MڝjpTPbWDTZ'OI
+={&NʕMZjSRYQ+bWD,TZ_~)NʅA|guJRk*JEŋr\jѤf 9%vBA,VĮ`Be*JoF. Ҥqloo/5KHk*CXEo 'IKrJ4 !jEq,TZw}'NʅA͛l fے{֢tQ+~&Nʅ YBNQBM],ıPZT.j?I
+~_ʅravФ}j(f c5Z??ȅravYBNOf#D]"֢tQ+I
+׿ErYB^9vBAVĮ`Y Z-S+w(S%?o~=|ƍL0&j:
+?C.,Rf,VĮ`BewTZʅ2OoѣG7ofЬ 68fEBdKrvX*Y(*VĮ`Be$>l?w/~ɓ[nfjhYB^eE+"XıPŹ e/˧O޾}{iiizz%`=KHm,! -8>KHmyPoLHmu=\?KHmQYSA5y4} NYoL]<G7jpT<7h`,y'$~qQZAXf y%iظ{ӧOҸ(I ,@
+-Mr+U
+aE.jK1STGE^phMcuR
+ PN=,!'] ŵi\VyP.=,!'IpZjUZ,5K)qѬuliENj=يYjYBXۢqWZ.,!'$֢r*t@QZPP\ENj%0f 9=N}u,UuRTV5Kix)ͺ(IG5u^!f&X:U ;,!4\'5Ҙf 9!jVcE.j`%kVR\'Z15KBVf]:YBNf߱mToEZH%ErB,&poN-D.,5K q׬]e\pE,!$ٖqTvq`YBNȱ+ KN+N BjjXEވ)AHmpz*N BjZ 6Z%N BjZ 6Z%N B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!g;B!B!B!B!B!r
+LaUӮzvô]'r Z I!Y0}ag{l!Fb,C+zaaVHa]?7nNvzӣhG;=Nvzڽ
+ǧY+^˞̟}&o4~ښseЋLVkVrZwd:yc2.;r žg
+s$]ǫʘsel'IAݖU ][xa4c{QP2p3{6z2˓=<{ھ`Aֿ7|koͻN%Us&ġs,Y^& GiYj1Ⱥyx7x\tb<({gqG^o7-/oyU= = ܣ2\ޑ./f9ƎM`AW"DɨCXhlLMxQ.Gj=Ǝp]$n}kcǮd':U}N?]N=z_p=Ma%V]p`&7<&%ow?r kq%l6[SN,kΑioMU]6-0^knn8w'Mط6o
+K7.3Y`Y%vj5ޕ+{ѷƺ\Xr<;IExIr h8n˪ޣ((}GYG{<yј;p\;e$gX=vmx=<{ھ`Aֿ7|koͻNUs&qЎ 4y{Y\ϳ޽LƏrӺbuw~p{o yPd k,oZQ_L~?{,9z GB.w/Y,c˳j]vimTlOO9^ٹ>Vw9eq<( $N';ϋC3XQ}{AZcmks乜}[ںiVðImv/h]/?9<FOyo=}z+ЫNw/]"ISM9}6-o6.t7<>
+0' 0'8ҜM Ѝ_3z+v5<lxӣ\Os兮i
+HԗKI+ri/nvK6# n K1#w}=6AVEeDFF8ykskg=637Ə)X߂orSSɄm||==>LxӃ3ȇߛ7e<~->L6S{.6sIJu֥fbK69or6l붗KTbi(fs}_w=OM}.TANasdliu[^FČx+l{GoNGaͫzr~z\ݼsy̱9Ale1g7G<0].'NCFXC%X%Xm% 'eZfz(-ia ;tFIwCUsŗ]79[|,UѸ
+ID.~i/WҺ߳=}f$'bɴ.]~zrk^;|4Oo6:<Yi8|&E)Ch*.+9,ĕoCL(f8lK+i6=EfH
+f
+z0M`FiK[ͦʙ*aÇZ7184Ӡo3``꾣/gOmm<%Ms(A=6H{'$;o]QQ*9;+,C-.Bx؎}VxG;XZdkM6 עΛ%ErlBFQxw|]-fG0Eyҍئԣ(ĺ] :.kK꜡j.FlId`kj`Ƅ
+> p<ZjgY24=0
+7C\B@!tǛt?T~3^MD5Us(ҷPgUV)!p8
+"XL}zfPAj'^; tR#V E >,9s NTF vԅiǑ6r1(d<<%*tjQ1"GIPu(2LTAЛ=X-ĜHz<@6L.ڛxLY|sl]! M>9fŨs\p
+(3|]&dmdˬPa26<U8
+JniΆLḦY]Y8Bٴ֡**TsfBo ,/~]L , R25R*u9n8t, %~
+=Jɔ>Ta.`phv|jPU~A 
+PpSYF4@4dA҆ uQlHGǮFcVos~tݗs;kLQ6Fq2p ȊOǖ< jJdZgIUaQ#'#63-*4>0 C<OH:ehG(ĔUJ-${<WI EJFkoW,N&Q& ڹD}#aƖ,?Hփn/!;PE(4H3q"
+gbqQQJ9y=jg,&d. @L4cWגxdH7EԢRB E+vo;Y֪yV,/~[W4{FAj.@A'3%w:
+($
+ҵTi$bƆmwo
+r Gt406܈FA,[kADRo$DT;$OYgOV (&Enwvd $},:3Inf@ a 7!3sC`7w 1H.+
+oGh~w7|*.eU!Fd:r'K~ICq$PU#)P
+q
+/GS0 gs
+486 0 0 480 273.6162109 546.6401367 cm
+/Im0 Do
+Q
+ endstream endobj 757 0 obj <</BBox[317.616 983.64 715.616 585.64]/Group 915 0 R/Length 59/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ColorSpace<</CS0 788 0 R>>/ExtGState<</GS0 916 0 R>>/ProcSet[/PDF/ImageC/ImageI]/XObject<</Im0 793 0 R>>>>/Subtype/Form>>stream
+q
+/GS0 gs
+398 0 0 398 317.6162109 585.6401367 cm
+/Im0 Do
+Q
+ endstream endobj 758 0 obj <</BBox[385.616 858.64 653.616 814.64]/Group 917 0 R/Length 58/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ColorSpace<</CS0 788 0 R>>/ExtGState<</GS0 918 0 R>>/ProcSet[/PDF/ImageC/ImageI]/XObject<</Im0 796 0 R>>>>/Subtype/Form>>stream
+q
+/GS0 gs
+268 0 0 44 385.6162109 814.6401367 cm
+/Im0 Do
+Q
+ endstream endobj 759 0 obj <</BBox[382.616 888.64 656.616 585.64]/Group 919 0 R/Length 59/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ColorSpace<</CS0 788 0 R>>/ExtGState<</GS0 920 0 R>>/ProcSet[/PDF/ImageC/ImageI]/XObject<</Im0 799 0 R>>>>/Subtype/Form>>stream
+q
+/GS0 gs
+274 0 0 303 382.6162109 585.6401367 cm
+/Im0 Do
+Q
+ endstream endobj 760 0 obj <</BBox[408.0 947.0 704.0 856.0]/Group 921 0 R/Length 42/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ColorSpace<</CS0 788 0 R>>/ExtGState<</GS0 922 0 R>>/ProcSet[/PDF/ImageC/ImageI]/XObject<</Im0 802 0 R>>>>/Subtype/Form>>stream
+q
+/GS0 gs
+296 0 0 91 408 856 cm
+/Im0 Do
+Q
+ endstream endobj 761 0 obj <</BBox[246.0 1106.0 718.0 580.0]/Group 923 0 R/Length 43/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ColorSpace<</CS0 788 0 R>>/ExtGState<</GS0 924 0 R>>/ProcSet[/PDF/ImageC/ImageI]/XObject<</Im0 805 0 R>>>>/Subtype/Form>>stream
+q
+/GS0 gs
+472 0 0 526 246 580 cm
+/Im0 Do
+Q
+ endstream endobj 762 0 obj <</BBox[283.0 1022.0 796.0 520.0]/Group 925 0 R/Length 43/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ColorSpace<</CS0 788 0 R>>/ExtGState<</GS0 926 0 R>>/ProcSet[/PDF/ImageC/ImageI]/XObject<</Im0 808 0 R>>>>/Subtype/Form>>stream
+q
+/GS0 gs
+513 0 0 502 283 520 cm
+/Im0 Do
+Q
+ endstream endobj 925 0 obj <</I false/K false/S/Transparency/Type/Group>> endobj 926 0 obj <</AIS true/BM/Normal/CA 1.0/OP false/OPM 1/SA true/SMask 927 0 R/Type/ExtGState/ca 1.0/op false>> endobj 927 0 obj <</BC 928 0 R/G 929 0 R/S/Luminosity/Type/Mask>> endobj 928 0 obj [0.0 0.0 0.0] endobj 929 0 obj <</BBox[283.0 1022.0 796.0 520.0]/Group 930 0 R/Length 43/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ExtGState<</GS0 747 0 R>>/ProcSet[/PDF/ImageB]/XObject<</Im0 833 0 R>>>>/Subtype/Form>>stream
+q
+/GS0 gs
+513 0 0 502 283 520 cm
+/Im0 Do
+Q
+ endstream endobj 930 0 obj <</CS 735 0 R/I false/K false/S/Transparency/Type/Group>> endobj 923 0 obj <</I false/K false/S/Transparency/Type/Group>> endobj 924 0 obj <</AIS true/BM/Normal/CA 1.0/OP false/OPM 1/SA true/SMask 931 0 R/Type/ExtGState/ca 1.0/op false>> endobj 931 0 obj <</BC 932 0 R/G 933 0 R/S/Luminosity/Type/Mask>> endobj 932 0 obj [0.0 0.0 0.0] endobj 933 0 obj <</BBox[246.0 1106.0 718.0 580.0]/Group 934 0 R/Length 43/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ExtGState<</GS0 747 0 R>>/ProcSet[/PDF/ImageB]/XObject<</Im0 839 0 R>>>>/Subtype/Form>>stream
+q
+/GS0 gs
+472 0 0 526 246 580 cm
+/Im0 Do
+Q
+ endstream endobj 934 0 obj <</CS 735 0 R/I false/K false/S/Transparency/Type/Group>> endobj 921 0 obj <</I false/K false/S/Transparency/Type/Group>> endobj 922 0 obj <</AIS true/BM/Normal/CA 1.0/OP false/OPM 1/SA true/SMask 935 0 R/Type/ExtGState/ca 1.0/op false>> endobj 935 0 obj <</BC 936 0 R/G 937 0 R/S/Luminosity/Type/Mask>> endobj 936 0 obj [0.0 0.0 0.0] endobj 937 0 obj <</BBox[408.0 947.0 704.0 856.0]/Group 938 0 R/Length 42/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ExtGState<</GS0 747 0 R>>/ProcSet[/PDF/ImageB]/XObject<</Im0 845 0 R>>>>/Subtype/Form>>stream
+q
+/GS0 gs
+296 0 0 91 408 856 cm
+/Im0 Do
+Q
+ endstream endobj 938 0 obj <</CS 735 0 R/I false/K false/S/Transparency/Type/Group>> endobj 919 0 obj <</I false/K false/S/Transparency/Type/Group>> endobj 920 0 obj <</AIS true/BM/Normal/CA 1.0/OP false/OPM 1/SA true/SMask 939 0 R/Type/ExtGState/ca 1.0/op false>> endobj 939 0 obj <</BC 940 0 R/G 941 0 R/S/Luminosity/Type/Mask>> endobj 940 0 obj [0.0 0.0 0.0] endobj 941 0 obj <</BBox[382.616 888.64 656.616 585.64]/Group 942 0 R/Length 59/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ExtGState<</GS0 747 0 R>>/ProcSet[/PDF/ImageB]/XObject<</Im0 851 0 R>>>>/Subtype/Form>>stream
+q
+/GS0 gs
+274 0 0 303 382.6162109 585.6401367 cm
+/Im0 Do
+Q
+ endstream endobj 942 0 obj <</CS 735 0 R/I false/K false/S/Transparency/Type/Group>> endobj 917 0 obj <</I false/K false/S/Transparency/Type/Group>> endobj 918 0 obj <</AIS true/BM/Normal/CA 1.0/OP false/OPM 1/SA true/SMask 943 0 R/Type/ExtGState/ca 1.0/op false>> endobj 943 0 obj <</BC 944 0 R/G 945 0 R/S/Luminosity/Type/Mask>> endobj 944 0 obj [0.0 0.0 0.0] endobj 945 0 obj <</BBox[385.616 858.64 653.616 814.64]/Group 946 0 R/Length 58/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ExtGState<</GS0 747 0 R>>/ProcSet[/PDF/ImageB]/XObject<</Im0 857 0 R>>>>/Subtype/Form>>stream
+q
+/GS0 gs
+268 0 0 44 385.6162109 814.6401367 cm
+/Im0 Do
+Q
+ endstream endobj 946 0 obj <</CS 735 0 R/I false/K false/S/Transparency/Type/Group>> endobj 915 0 obj <</I false/K false/S/Transparency/Type/Group>> endobj 916 0 obj <</AIS true/BM/Normal/CA 1.0/OP false/OPM 1/SA true/SMask 947 0 R/Type/ExtGState/ca 1.0/op false>> endobj 947 0 obj <</BC 948 0 R/G 949 0 R/S/Luminosity/Type/Mask>> endobj 948 0 obj [0.0 0.0 0.0] endobj 949 0 obj <</BBox[317.616 983.64 715.616 585.64]/Group 950 0 R/Length 59/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ExtGState<</GS0 747 0 R>>/ProcSet[/PDF/ImageB]/XObject<</Im0 863 0 R>>>>/Subtype/Form>>stream
+q
+/GS0 gs
+398 0 0 398 317.6162109 585.6401367 cm
+/Im0 Do
+Q
+ endstream endobj 950 0 obj <</CS 735 0 R/I false/K false/S/Transparency/Type/Group>> endobj 913 0 obj <</I false/K false/S/Transparency/Type/Group>> endobj 914 0 obj <</AIS true/BM/Normal/CA 1.0/OP false/OPM 1/SA true/SMask 951 0 R/Type/ExtGState/ca 1.0/op false>> endobj 951 0 obj <</BC 952 0 R/G 953 0 R/S/Luminosity/Type/Mask>> endobj 952 0 obj [0.0 0.0 0.0] endobj 953 0 obj <</BBox[273.616 1026.64 759.616 546.64]/Group 954 0 R/Length 59/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ExtGState<</GS0 747 0 R>>/ProcSet[/PDF/ImageB]/XObject<</Im0 869 0 R>>>>/Subtype/Form>>stream
+q
+/GS0 gs
+486 0 0 480 273.6162109 546.6401367 cm
+/Im0 Do
+Q
+ endstream endobj 954 0 obj <</CS 735 0 R/I false/K false/S/Transparency/Type/Group>> endobj 746 0 obj <</AIS false/BM/Normal/CA 1.0/OP false/OPM 1/SA true/SMask 955 0 R/Type/ExtGState/ca 1.0/op false>> endobj 748 0 obj <</AIS false/BM/Normal/CA 1.0/OP false/OPM 1/SA true/SMask 956 0 R/Type/ExtGState/ca 1.0/op false>> endobj 749 0 obj <</AIS false/BM/Normal/CA 1.0/OP false/OPM 1/SA true/SMask 957 0 R/Type/ExtGState/ca 1.0/op false>> endobj 750 0 obj <</AIS false/BM/Normal/CA 1.0/OP false/OPM 1/SA true/SMask 958 0 R/Type/ExtGState/ca 1.0/op false>> endobj 751 0 obj <</AIS false/BM/Normal/CA 1.0/OP false/OPM 1/SA true/SMask 959 0 R/Type/ExtGState/ca 1.0/op false>> endobj 959 0 obj <</G 960 0 R/S/Luminosity/Type/Mask>> endobj 960 0 obj <</BBox[-32768.0 32767.0 32767.0 -32768.0]/Group 961 0 R/Length 84/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ExtGState<</GS0 744 0 R>>/Shading<</Sh0 892 0 R>>>>/Subtype/Form>>stream
+q
+0 g
+/GS0 gs
+15.8993082 0 0 -16.1025677 1392.8847656 296.171875 cm
+BX /Sh0 sh EX Q
+ endstream endobj 961 0 obj <</CS/DeviceGray/I false/K false/S/Transparency/Type/Group>> endobj 958 0 obj <</G 962 0 R/S/Luminosity/Type/Mask>> endobj 962 0 obj <</BBox[-32768.0 32767.0 32767.0 -32768.0]/Group 963 0 R/Length 85/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ExtGState<</GS0 744 0 R>>/Shading<</Sh0 892 0 R>>>>/Subtype/Form>>stream
+q
+0 g
+/GS0 gs
+11.9217148 0 0 -12.0797682 1392.7294922 335.4882812 cm
+BX /Sh0 sh EX Q
+ endstream endobj 963 0 obj <</CS/DeviceGray/I false/K false/S/Transparency/Type/Group>> endobj 957 0 obj <</G 964 0 R/S/Luminosity/Type/Mask>> endobj 964 0 obj <</BBox[-32768.0 32767.0 32767.0 -32768.0]/Group 965 0 R/Length 87/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ExtGState<</GS0 744 0 R>>/Shading<</Sh0 892 0 R>>>>/Subtype/Form>>stream
+q
+0 g
+/GS0 gs
+225.9361572 0 0 -225.9361572 1389.9453125 728.7958984 cm
+BX /Sh0 sh EX Q
+ endstream endobj 965 0 obj <</CS/DeviceGray/I false/K false/S/Transparency/Type/Group>> endobj 956 0 obj <</G 966 0 R/S/Luminosity/Type/Mask>> endobj 966 0 obj <</BBox[-32768.0 32767.0 32767.0 -32768.0]/Group 967 0 R/Length 83/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ExtGState<</GS0 744 0 R>>/Shading<</Sh0 892 0 R>>>>/Subtype/Form>>stream
+q
+0 g
+/GS0 gs
+7.9551892 0 0 -8.0455885 1392.7294922 366.4384766 cm
+BX /Sh0 sh EX Q
+ endstream endobj 967 0 obj <</CS/DeviceGray/I false/K false/S/Transparency/Type/Group>> endobj 955 0 obj <</G 968 0 R/S/Luminosity/Type/Mask>> endobj 968 0 obj <</BBox[-32768.0 32767.0 32767.0 -32768.0]/Group 969 0 R/Length 84/Matrix[1.0 0.0 0.0 1.0 0.0 0.0]/Resources<</ExtGState<</GS0 744 0 R>>/Shading<</Sh0 892 0 R>>>>/Subtype/Form>>stream
+q
+0 g
+/GS0 gs
+225.9359131 0 0 -225.9359131 509.96875 794.0385742 cm
+BX /Sh0 sh EX Q
+ endstream endobj 969 0 obj <</CS/DeviceGray/I false/K false/S/Transparency/Type/Group>> endobj 912 0 obj [/ICCBased 819 0 R] endobj 5 0 obj <</Intent 154 0 R/Name(Calque 1)/Type/OCG/Usage 155 0 R>> endobj 248 0 obj <</Intent 395 0 R/Name(Calque 1)/Type/OCG/Usage 396 0 R>> endobj 489 0 obj <</Intent 636 0 R/Name(Calque 1)/Type/OCG/Usage 637 0 R>> endobj 636 0 obj [/View/Design] endobj 637 0 obj <</CreatorInfo<</Creator(Adobe Illustrator 16.0)/Subtype/Artwork>>>> endobj 395 0 obj [/View/Design] endobj 396 0 obj <</CreatorInfo<</Creator(Adobe Illustrator 16.0)/Subtype/Artwork>>>> endobj 154 0 obj [/View/Design] endobj 155 0 obj <</CreatorInfo<</Creator(Adobe Illustrator 16.0)/Subtype/Artwork>>>> endobj 731 0 obj [730 0 R] endobj 970 0 obj <</CreationDate(D:20140916123631+02'00')/Creator(Adobe Illustrator CS6 \(Macintosh\))/ModDate(D:20140918115258+02'00')/Producer(Adobe PDF library 10.01)/Title(logotalerv2)>> endobj xref 0 971 0000000004 65535 f
+0000000016 00000 n
+0000000194 00000 n
+0000050669 00000 n
+0000000006 00000 f
+0000539738 00000 n
+0000000009 00000 f
+0000050726 00000 n
+0000051599 00000 n
+0000000010 00000 f
+0000000011 00000 f
+0000000012 00000 f
+0000000013 00000 f
+0000000014 00000 f
+0000000015 00000 f
+0000000016 00000 f
+0000000017 00000 f
+0000000018 00000 f
+0000000019 00000 f
+0000000020 00000 f
+0000000021 00000 f
+0000000022 00000 f
+0000000023 00000 f
+0000000024 00000 f
+0000000025 00000 f
+0000000026 00000 f
+0000000027 00000 f
+0000000028 00000 f
+0000000029 00000 f
+0000000030 00000 f
+0000000031 00000 f
+0000000032 00000 f
+0000000033 00000 f
+0000000034 00000 f
+0000000035 00000 f
+0000000036 00000 f
+0000000037 00000 f
+0000000038 00000 f
+0000000039 00000 f
+0000000040 00000 f
+0000000041 00000 f
+0000000042 00000 f
+0000000043 00000 f
+0000000044 00000 f
+0000000045 00000 f
+0000000046 00000 f
+0000000047 00000 f
+0000000048 00000 f
+0000000049 00000 f
+0000000050 00000 f
+0000000051 00000 f
+0000000052 00000 f
+0000000053 00000 f
+0000000054 00000 f
+0000000055 00000 f
+0000000056 00000 f
+0000000057 00000 f
+0000000058 00000 f
+0000000059 00000 f
+0000000060 00000 f
+0000000061 00000 f
+0000000062 00000 f
+0000000063 00000 f
+0000000064 00000 f
+0000000065 00000 f
+0000000066 00000 f
+0000000067 00000 f
+0000000068 00000 f
+0000000069 00000 f
+0000000070 00000 f
+0000000071 00000 f
+0000000072 00000 f
+0000000073 00000 f
+0000000074 00000 f
+0000000075 00000 f
+0000000076 00000 f
+0000000077 00000 f
+0000000078 00000 f
+0000000079 00000 f
+0000000080 00000 f
+0000000081 00000 f
+0000000082 00000 f
+0000000083 00000 f
+0000000084 00000 f
+0000000085 00000 f
+0000000086 00000 f
+0000000087 00000 f
+0000000088 00000 f
+0000000089 00000 f
+0000000090 00000 f
+0000000091 00000 f
+0000000092 00000 f
+0000000093 00000 f
+0000000094 00000 f
+0000000095 00000 f
+0000000096 00000 f
+0000000097 00000 f
+0000000098 00000 f
+0000000099 00000 f
+0000000100 00000 f
+0000000101 00000 f
+0000000102 00000 f
+0000000103 00000 f
+0000000104 00000 f
+0000000105 00000 f
+0000000106 00000 f
+0000000107 00000 f
+0000000108 00000 f
+0000000109 00000 f
+0000000110 00000 f
+0000000111 00000 f
+0000000112 00000 f
+0000000113 00000 f
+0000000114 00000 f
+0000000115 00000 f
+0000000116 00000 f
+0000000117 00000 f
+0000000118 00000 f
+0000000119 00000 f
+0000000120 00000 f
+0000000121 00000 f
+0000000122 00000 f
+0000000123 00000 f
+0000000124 00000 f
+0000000125 00000 f
+0000000126 00000 f
+0000000127 00000 f
+0000000128 00000 f
+0000000129 00000 f
+0000000130 00000 f
+0000000131 00000 f
+0000000132 00000 f
+0000000133 00000 f
+0000000134 00000 f
+0000000135 00000 f
+0000000136 00000 f
+0000000137 00000 f
+0000000138 00000 f
+0000000139 00000 f
+0000000140 00000 f
+0000000141 00000 f
+0000000142 00000 f
+0000000143 00000 f
+0000000144 00000 f
+0000000145 00000 f
+0000000146 00000 f
+0000000147 00000 f
+0000000148 00000 f
+0000000149 00000 f
+0000000150 00000 f
+0000000151 00000 f
+0000000152 00000 f
+0000000153 00000 f
+0000000156 00000 f
+0000540197 00000 n
+0000540229 00000 n
+0000000157 00000 f
+0000000158 00000 f
+0000000159 00000 f
+0000000160 00000 f
+0000000161 00000 f
+0000000162 00000 f
+0000000163 00000 f
+0000000164 00000 f
+0000000165 00000 f
+0000000166 00000 f
+0000000167 00000 f
+0000000168 00000 f
+0000000169 00000 f
+0000000170 00000 f
+0000000171 00000 f
+0000000172 00000 f
+0000000173 00000 f
+0000000174 00000 f
+0000000175 00000 f
+0000000176 00000 f
+0000000177 00000 f
+0000000178 00000 f
+0000000179 00000 f
+0000000180 00000 f
+0000000181 00000 f
+0000000182 00000 f
+0000000183 00000 f
+0000000184 00000 f
+0000000185 00000 f
+0000000186 00000 f
+0000000187 00000 f
+0000000188 00000 f
+0000000189 00000 f
+0000000190 00000 f
+0000000191 00000 f
+0000000192 00000 f
+0000000193 00000 f
+0000000194 00000 f
+0000000195 00000 f
+0000000196 00000 f
+0000000197 00000 f
+0000000198 00000 f
+0000000199 00000 f
+0000000200 00000 f
+0000000201 00000 f
+0000000202 00000 f
+0000000203 00000 f
+0000000204 00000 f
+0000000205 00000 f
+0000000206 00000 f
+0000000207 00000 f
+0000000208 00000 f
+0000000209 00000 f
+0000000210 00000 f
+0000000211 00000 f
+0000000212 00000 f
+0000000213 00000 f
+0000000214 00000 f
+0000000215 00000 f
+0000000216 00000 f
+0000000217 00000 f
+0000000218 00000 f
+0000000219 00000 f
+0000000220 00000 f
+0000000221 00000 f
+0000000222 00000 f
+0000000223 00000 f
+0000000224 00000 f
+0000000225 00000 f
+0000000226 00000 f
+0000000227 00000 f
+0000000228 00000 f
+0000000229 00000 f
+0000000230 00000 f
+0000000231 00000 f
+0000000232 00000 f
+0000000233 00000 f
+0000000234 00000 f
+0000000235 00000 f
+0000000236 00000 f
+0000000237 00000 f
+0000000238 00000 f
+0000000239 00000 f
+0000000240 00000 f
+0000000241 00000 f
+0000000242 00000 f
+0000000243 00000 f
+0000000244 00000 f
+0000000245 00000 f
+0000000246 00000 f
+0000000247 00000 f
+0000000249 00000 f
+0000539811 00000 n
+0000000250 00000 f
+0000000251 00000 f
+0000000252 00000 f
+0000000253 00000 f
+0000000254 00000 f
+0000000255 00000 f
+0000000256 00000 f
+0000000257 00000 f
+0000000258 00000 f
+0000000259 00000 f
+0000000260 00000 f
+0000000261 00000 f
+0000000262 00000 f
+0000000263 00000 f
+0000000264 00000 f
+0000000265 00000 f
+0000000266 00000 f
+0000000267 00000 f
+0000000268 00000 f
+0000000269 00000 f
+0000000270 00000 f
+0000000271 00000 f
+0000000272 00000 f
+0000000273 00000 f
+0000000274 00000 f
+0000000275 00000 f
+0000000276 00000 f
+0000000277 00000 f
+0000000278 00000 f
+0000000279 00000 f
+0000000280 00000 f
+0000000281 00000 f
+0000000282 00000 f
+0000000283 00000 f
+0000000284 00000 f
+0000000285 00000 f
+0000000286 00000 f
+0000000287 00000 f
+0000000288 00000 f
+0000000289 00000 f
+0000000290 00000 f
+0000000291 00000 f
+0000000292 00000 f
+0000000293 00000 f
+0000000294 00000 f
+0000000295 00000 f
+0000000296 00000 f
+0000000297 00000 f
+0000000298 00000 f
+0000000299 00000 f
+0000000300 00000 f
+0000000301 00000 f
+0000000302 00000 f
+0000000303 00000 f
+0000000304 00000 f
+0000000305 00000 f
+0000000306 00000 f
+0000000307 00000 f
+0000000308 00000 f
+0000000309 00000 f
+0000000310 00000 f
+0000000311 00000 f
+0000000312 00000 f
+0000000313 00000 f
+0000000314 00000 f
+0000000315 00000 f
+0000000316 00000 f
+0000000317 00000 f
+0000000318 00000 f
+0000000319 00000 f
+0000000320 00000 f
+0000000321 00000 f
+0000000322 00000 f
+0000000323 00000 f
+0000000324 00000 f
+0000000325 00000 f
+0000000326 00000 f
+0000000327 00000 f
+0000000328 00000 f
+0000000329 00000 f
+0000000330 00000 f
+0000000331 00000 f
+0000000332 00000 f
+0000000333 00000 f
+0000000334 00000 f
+0000000335 00000 f
+0000000336 00000 f
+0000000337 00000 f
+0000000338 00000 f
+0000000339 00000 f
+0000000340 00000 f
+0000000341 00000 f
+0000000342 00000 f
+0000000343 00000 f
+0000000344 00000 f
+0000000345 00000 f
+0000000346 00000 f
+0000000347 00000 f
+0000000348 00000 f
+0000000349 00000 f
+0000000350 00000 f
+0000000351 00000 f
+0000000352 00000 f
+0000000353 00000 f
+0000000354 00000 f
+0000000355 00000 f
+0000000356 00000 f
+0000000357 00000 f
+0000000358 00000 f
+0000000359 00000 f
+0000000360 00000 f
+0000000361 00000 f
+0000000362 00000 f
+0000000363 00000 f
+0000000364 00000 f
+0000000365 00000 f
+0000000366 00000 f
+0000000367 00000 f
+0000000368 00000 f
+0000000369 00000 f
+0000000370 00000 f
+0000000371 00000 f
+0000000372 00000 f
+0000000373 00000 f
+0000000374 00000 f
+0000000375 00000 f
+0000000376 00000 f
+0000000377 00000 f
+0000000378 00000 f
+0000000379 00000 f
+0000000380 00000 f
+0000000381 00000 f
+0000000382 00000 f
+0000000383 00000 f
+0000000384 00000 f
+0000000385 00000 f
+0000000386 00000 f
+0000000387 00000 f
+0000000388 00000 f
+0000000389 00000 f
+0000000390 00000 f
+0000000391 00000 f
+0000000392 00000 f
+0000000393 00000 f
+0000000394 00000 f
+0000000397 00000 f
+0000540079 00000 n
+0000540111 00000 n
+0000000398 00000 f
+0000000399 00000 f
+0000000400 00000 f
+0000000401 00000 f
+0000000402 00000 f
+0000000403 00000 f
+0000000404 00000 f
+0000000405 00000 f
+0000000406 00000 f
+0000000407 00000 f
+0000000408 00000 f
+0000000409 00000 f
+0000000410 00000 f
+0000000411 00000 f
+0000000412 00000 f
+0000000413 00000 f
+0000000414 00000 f
+0000000415 00000 f
+0000000416 00000 f
+0000000417 00000 f
+0000000418 00000 f
+0000000419 00000 f
+0000000420 00000 f
+0000000421 00000 f
+0000000422 00000 f
+0000000423 00000 f
+0000000424 00000 f
+0000000425 00000 f
+0000000426 00000 f
+0000000427 00000 f
+0000000428 00000 f
+0000000429 00000 f
+0000000430 00000 f
+0000000431 00000 f
+0000000432 00000 f
+0000000433 00000 f
+0000000434 00000 f
+0000000435 00000 f
+0000000436 00000 f
+0000000437 00000 f
+0000000438 00000 f
+0000000439 00000 f
+0000000440 00000 f
+0000000441 00000 f
+0000000442 00000 f
+0000000443 00000 f
+0000000444 00000 f
+0000000445 00000 f
+0000000446 00000 f
+0000000447 00000 f
+0000000448 00000 f
+0000000449 00000 f
+0000000450 00000 f
+0000000451 00000 f
+0000000452 00000 f
+0000000453 00000 f
+0000000454 00000 f
+0000000455 00000 f
+0000000456 00000 f
+0000000457 00000 f
+0000000458 00000 f
+0000000459 00000 f
+0000000460 00000 f
+0000000461 00000 f
+0000000462 00000 f
+0000000463 00000 f
+0000000464 00000 f
+0000000465 00000 f
+0000000466 00000 f
+0000000467 00000 f
+0000000468 00000 f
+0000000469 00000 f
+0000000470 00000 f
+0000000471 00000 f
+0000000472 00000 f
+0000000473 00000 f
+0000000474 00000 f
+0000000475 00000 f
+0000000476 00000 f
+0000000477 00000 f
+0000000478 00000 f
+0000000479 00000 f
+0000000480 00000 f
+0000000481 00000 f
+0000000482 00000 f
+0000000483 00000 f
+0000000484 00000 f
+0000000485 00000 f
+0000000486 00000 f
+0000000487 00000 f
+0000000488 00000 f
+0000000000 00000 f
+0000539886 00000 n
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000539961 00000 n
+0000539993 00000 n
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000000000 00000 f
+0000255776 00000 n
+0000540315 00000 n
+0000526925 00000 n
+0000530281 00000 n
+0000272389 00000 n
+0000072965 00000 n
+0000080180 00000 n
+0000077135 00000 n
+0000078917 00000 n
+0000078454 00000 n
+0000076711 00000 n
+0000076244 00000 n
+0000075807 00000 n
+0000072621 00000 n
+0000268801 00000 n
+0000268915 00000 n
+0000536963 00000 n
+0000100986 00000 n
+0000537080 00000 n
+0000537197 00000 n
+0000537314 00000 n
+0000537431 00000 n
+0000255969 00000 n
+0000257133 00000 n
+0000257476 00000 n
+0000254768 00000 n
+0000530345 00000 n
+0000530669 00000 n
+0000530992 00000 n
+0000531314 00000 n
+0000531637 00000 n
+0000531937 00000 n
+0000532239 00000 n
+0000058286 00000 n
+0000058829 00000 n
+0000064795 00000 n
+0000065059 00000 n
+0000065376 00000 n
+0000071367 00000 n
+0000071636 00000 n
+0000071964 00000 n
+0000072239 00000 n
+0000052478 00000 n
+0000055983 00000 n
+0000269032 00000 n
+0000269149 00000 n
+0000269266 00000 n
+0000269383 00000 n
+0000269500 00000 n
+0000056047 00000 n
+0000056374 00000 n
+0000056701 00000 n
+0000057027 00000 n
+0000057354 00000 n
+0000057664 00000 n
+0000057975 00000 n
+0000526888 00000 n
+0000199803 00000 n
+0000081996 00000 n
+0000228123 00000 n
+0000199867 00000 n
+0000155074 00000 n
+0000178049 00000 n
+0000155138 00000 n
+0000151139 00000 n
+0000153025 00000 n
+0000151203 00000 n
+0000140569 00000 n
+0000146002 00000 n
+0000140633 00000 n
+0000126432 00000 n
+0000133614 00000 n
+0000126496 00000 n
+0000101099 00000 n
+0000114198 00000 n
+0000101163 00000 n
+0000080732 00000 n
+0000091259 00000 n
+0000080796 00000 n
+0000080227 00000 n
+0000079327 00000 n
+0000078963 00000 n
+0000078501 00000 n
+0000077183 00000 n
+0000076758 00000 n
+0000076291 00000 n
+0000075854 00000 n
+0000072668 00000 n
+0000073002 00000 n
+0000073158 00000 n
+0000076140 00000 n
+0000076586 00000 n
+0000077043 00000 n
+0000078037 00000 n
+0000078795 00000 n
+0000079247 00000 n
+0000080558 00000 n
+0000082042 00000 n
+0000091204 00000 n
+0000091375 00000 n
+0000091441 00000 n
+0000091472 00000 n
+0000091749 00000 n
+0000091824 00000 n
+0000102529 00000 n
+0000114314 00000 n
+0000114380 00000 n
+0000114411 00000 n
+0000114688 00000 n
+0000114763 00000 n
+0000127223 00000 n
+0000133730 00000 n
+0000133796 00000 n
+0000133827 00000 n
+0000134103 00000 n
+0000134178 00000 n
+0000141446 00000 n
+0000146118 00000 n
+0000146184 00000 n
+0000146215 00000 n
+0000146508 00000 n
+0000146583 00000 n
+0000151556 00000 n
+0000153141 00000 n
+0000153207 00000 n
+0000153238 00000 n
+0000153530 00000 n
+0000153605 00000 n
+0000156876 00000 n
+0000178165 00000 n
+0000178231 00000 n
+0000178262 00000 n
+0000178555 00000 n
+0000178630 00000 n
+0000202059 00000 n
+0000228239 00000 n
+0000228305 00000 n
+0000228336 00000 n
+0000228629 00000 n
+0000228704 00000 n
+0000254922 00000 n
+0000255143 00000 n
+0000255262 00000 n
+0000255367 00000 n
+0000255458 00000 n
+0000255549 00000 n
+0000255655 00000 n
+0000255851 00000 n
+0000255883 00000 n
+0000268483 00000 n
+0000268571 00000 n
+0000265290 00000 n
+0000257856 00000 n
+0000258107 00000 n
+0000265561 00000 n
+0000271957 00000 n
+0000271527 00000 n
+0000271093 00000 n
+0000270661 00000 n
+0000269617 00000 n
+0000269672 00000 n
+0000269970 00000 n
+0000270048 00000 n
+0000270205 00000 n
+0000270426 00000 n
+0000270501 00000 n
+0000270581 00000 n
+0000270716 00000 n
+0000271015 00000 n
+0000271148 00000 n
+0000271449 00000 n
+0000271582 00000 n
+0000271879 00000 n
+0000272012 00000 n
+0000272311 00000 n
+0000272465 00000 n
+0000272712 00000 n
+0000273723 00000 n
+0000284180 00000 n
+0000349769 00000 n
+0000415358 00000 n
+0000480947 00000 n
+0000539701 00000 n
+0000536321 00000 n
+0000536385 00000 n
+0000535680 00000 n
+0000535744 00000 n
+0000535040 00000 n
+0000535104 00000 n
+0000534399 00000 n
+0000534463 00000 n
+0000533781 00000 n
+0000533845 00000 n
+0000533161 00000 n
+0000533225 00000 n
+0000532541 00000 n
+0000532605 00000 n
+0000532721 00000 n
+0000532787 00000 n
+0000532818 00000 n
+0000533086 00000 n
+0000533341 00000 n
+0000533407 00000 n
+0000533438 00000 n
+0000533706 00000 n
+0000533961 00000 n
+0000534027 00000 n
+0000534058 00000 n
+0000534324 00000 n
+0000534579 00000 n
+0000534645 00000 n
+0000534676 00000 n
+0000534965 00000 n
+0000535220 00000 n
+0000535286 00000 n
+0000535317 00000 n
+0000535605 00000 n
+0000535860 00000 n
+0000535926 00000 n
+0000535957 00000 n
+0000536246 00000 n
+0000536501 00000 n
+0000536567 00000 n
+0000536598 00000 n
+0000536888 00000 n
+0000539271 00000 n
+0000538842 00000 n
+0000538409 00000 n
+0000537978 00000 n
+0000537548 00000 n
+0000537603 00000 n
+0000537900 00000 n
+0000538033 00000 n
+0000538331 00000 n
+0000538464 00000 n
+0000538764 00000 n
+0000538897 00000 n
+0000539193 00000 n
+0000539326 00000 n
+0000539623 00000 n
+0000540342 00000 n
+trailer <</Size 971/Root 1 0 R/Info 970 0 R/ID[<07511D2C75694DC89622C9F4B35B7624><8DE5252BE861447E9DAABAECF80D68A1>]>> startxref 540533 %%EOF \ No newline at end of file
diff --git a/doc/logos/eps/icon_taler.eps b/doc/logos/eps/icon_taler.eps
new file mode 100644
index 00000000..79ab648a
--- /dev/null
+++ b/doc/logos/eps/icon_taler.eps
Binary files differ
diff --git a/doc/logos/eps/logo_taler.eps b/doc/logos/eps/logo_taler.eps
new file mode 100644
index 00000000..34312849
--- /dev/null
+++ b/doc/logos/eps/logo_taler.eps
Binary files differ
diff --git a/doc/logos/fonts/OldNewspaperTypes.ttf b/doc/logos/fonts/OldNewspaperTypes.ttf
new file mode 100755
index 00000000..7b9cf31b
--- /dev/null
+++ b/doc/logos/fonts/OldNewspaperTypes.ttf
Binary files differ
diff --git a/doc/logos/fonts/perpetue/Perpetua Bold Italic.ttf b/doc/logos/fonts/perpetue/Perpetua Bold Italic.ttf
new file mode 100644
index 00000000..3882fe92
--- /dev/null
+++ b/doc/logos/fonts/perpetue/Perpetua Bold Italic.ttf
Binary files differ
diff --git a/doc/logos/fonts/perpetue/Perpetua Bold.ttf b/doc/logos/fonts/perpetue/Perpetua Bold.ttf
new file mode 100644
index 00000000..c73833db
--- /dev/null
+++ b/doc/logos/fonts/perpetue/Perpetua Bold.ttf
Binary files differ
diff --git a/doc/logos/fonts/perpetue/Perpetua Italic.ttf b/doc/logos/fonts/perpetue/Perpetua Italic.ttf
new file mode 100644
index 00000000..e4f295ed
--- /dev/null
+++ b/doc/logos/fonts/perpetue/Perpetua Italic.ttf
Binary files differ
diff --git a/doc/logos/fonts/perpetue/Perpetua.ttf b/doc/logos/fonts/perpetue/Perpetua.ttf
new file mode 100644
index 00000000..846b3dca
--- /dev/null
+++ b/doc/logos/fonts/perpetue/Perpetua.ttf
Binary files differ
diff --git a/doc/logos/fonts/smoth_bight/End User Licence Agreement.txt b/doc/logos/fonts/smoth_bight/End User Licence Agreement.txt
new file mode 100755
index 00000000..04209197
--- /dev/null
+++ b/doc/logos/fonts/smoth_bight/End User Licence Agreement.txt
@@ -0,0 +1,133 @@
+End User License Agreement and Software Inclusion Agreement
+
+
+"Purchaser" and "User" may be used interchangeably in this agreement.
+
+
+The official release page is at kustren.deviantart.com/
+
+or
+
+
+
+ Copyright 2013 Kustren
+ Trademark 2013 Kustren licence
+ Commercial distribution, rendering and printing of the font and derived work is prohibited.
+
+
+
+
+
+Usage
+
+Smoth-Bight is freeware Font is free to use for personal and commercial purposes. No payment is necessary, and there is no limit to the amount of prints, pages, or other medium to be produced using them. However, you cannot offer the font for commercial sale, or offer for direct download. The inclusion othe font name and/or site URL in the credits or documentation when it is used is appreciated, but this is not mandatory.
+My font is for personal and commercial use, can be used for any type of work, while nature, neither will be able to be modified in any kind of way.
+This license is multipurpose, my font can be used on multiple computers at once.
+
+
+
+
+
+Payment
+
+Payment is not required for the use of kustren's freeware Font.
+
+
+
+Support
+
+If you experience problems with any Kustren's Freeware font (such as spacing issues or missing characters), please verify that you have the correct and current version of the fonts. In the case of Freeware font, downloading the font directly from the http://kustren.deviantart.com/ site will ensure that the font files have not been altered.
+
+
+
+
+Copyright (c) 2014 by Kustren. All rights reserved.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
diff --git a/doc/logos/fonts/smoth_bight/Licencia de la fuente - Version en Espa§ol.txt b/doc/logos/fonts/smoth_bight/Licencia de la fuente - Version en Espa§ol.txt
new file mode 100755
index 00000000..39833a36
--- /dev/null
+++ b/doc/logos/fonts/smoth_bight/Licencia de la fuente - Version en Espa§ol.txt
@@ -0,0 +1,77 @@
+Contrato de licencia de usuario final e Inclusin del acuerdo de Software
+
+"Comprador " y "Usuario " se pueden utilizar indistintamente en el presente acuerdo .
+
+
+La pgina oficial de lanzamiento de la fuente es:
+http://kustren.deviantart.com/
+
+
+
+ Derechos de autor 2013 Kustren
+ Marcas 2013 licencia Kustren
+ Se prohbe la distribucin comercial, la representacin y la impresin de la fuente y el trabajo derivado .
+
+
+
+
+
+Uso
+
+La fuente de Kustren llamada Smoth-Bight es freware en su mayoria, de uso libre, pero solo para fines personales y/o comerciales, no hay limite en la cantidad de copias realizadas de la mis ma fuente en los pcs que usted utilice.
+Sin embargo no pueden ofrecer esta tipografia ni como suyas y/o comercializarla, tampoco estara permitida la descarga directa en otras paginas web, a menos que sea con consentimiento de su creador Kustren.
+Si usted usa mi fuente deme creditos por ello y/o coloque la pagina web mia, esto es de agradecer.
+
+licencia del derecho de uso
+
+Esta fuente es para uso personal y/o comercial, puede ser usadas para cualquier tipo de trabajo, pero no podra ser modificadas de ningun tipo de manera.
+Recuerden que si ustedes compran alguna tipografia no se convierten en propietariuo de la fuente, solo obtienen la licencia de uso, es decir la misma que estan leyendo.
+Esta licencia es de multiuso, mi fuente pueden ser usadas en multiples computadores a la vez.
+
+
+
+
+
+pago
+
+El pago no es necesaria para el uso de esta fuente de software gratuito creada por kustren.
+
+
+
+apoyo
+
+Si tienen problema con la fuente (como problemas de espaciado o caracteres que faltan ) , por favor, compruebe que tiene la versin correcta y actualizada de la fuente. En el caso de fuentes de dominio pblico , la descarga de la fuente directamente desde el sitio http://kustren.deviantart.com/ se asegurar de que los archivos de fuentes no han sido alterados.
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
diff --git a/doc/logos/fonts/smoth_bight/Smoth-Bight - Por Kustren.otf b/doc/logos/fonts/smoth_bight/Smoth-Bight - Por Kustren.otf
new file mode 100755
index 00000000..33fd9793
--- /dev/null
+++ b/doc/logos/fonts/smoth_bight/Smoth-Bight - Por Kustren.otf
Binary files differ
diff --git a/doc/logos/fonts/smoth_bight/Smoth-Bight Italic - Por Kustren.otf b/doc/logos/fonts/smoth_bight/Smoth-Bight Italic - Por Kustren.otf
new file mode 100755
index 00000000..5fb25e64
--- /dev/null
+++ b/doc/logos/fonts/smoth_bight/Smoth-Bight Italic - Por Kustren.otf
Binary files differ
diff --git a/doc/logos/ico/favicon1616.ico b/doc/logos/ico/favicon1616.ico
new file mode 100644
index 00000000..141b93d3
--- /dev/null
+++ b/doc/logos/ico/favicon1616.ico
Binary files differ
diff --git a/doc/logos/ico/favicon4848.ico b/doc/logos/ico/favicon4848.ico
new file mode 100644
index 00000000..3c04b126
--- /dev/null
+++ b/doc/logos/ico/favicon4848.ico
Binary files differ
diff --git a/doc/logos/png/icon_taler.png b/doc/logos/png/icon_taler.png
new file mode 100644
index 00000000..b1dd9a58
--- /dev/null
+++ b/doc/logos/png/icon_taler.png
Binary files differ
diff --git a/doc/logos/png/logo_taler.png b/doc/logos/png/logo_taler.png
new file mode 100644
index 00000000..bdffc3c9
--- /dev/null
+++ b/doc/logos/png/logo_taler.png
Binary files differ